KEGG   Nanorana parkeri: 108801819Help
Entry
108801819         CDS       T04897                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
npr  Nanorana parkeri
Pathway
npr00040  Pentose and glucuronate interconversions
npr00051  Fructose and mannose metabolism
npr01100  Metabolic pathways
Module
npr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    108801819 (SORD)
   00051 Fructose and mannose metabolism
    108801819 (SORD)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     108801819 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 108801819
NCBI-ProteinID: XP_018429236
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MAATKQFEENLSVVVHGVGDLRLENRPVPEPRPDEVLLKMHSVGICGSDVHYWQHGRIGD
FIVKKPMVLGHEASGTVVKVGSAVTHLKPGDRVAIEPGVPRETDEFCKTGRYNLSPNIFF
CATPPDDGNLCRYYTHNAHFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSQVFIC
GAGPIGLVSLIVAKMMGASQTVISDLSPSRLEKAKEVGADFLLQITNETPEQIARKVEEL
LGCMPEITIECTGAESCIQTGIYATRSGGTLILVGLGPAMVNVPIVNAAVREVDIRGIFR
YCNTWPMAISMLASKRVNVAPLVTHRFTLEKALDAFETTKRGVGVKVMLKCDKDDQSP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacaaagcagtttgaagagaacttgtctgtagtagtccatggagttggagat
cttcgcctggaaaaccgtccagttcctgaacctcgcccagatgaggtgctgctgaaaatg
cactcagtgggaatttgtggttcagatgtacattactggcagcatgggcgtattggagat
ttcattgtgaaaaaacccatggttcttggacatgaagcttcagggacagtggtgaaagta
ggatctgcagttactcatctcaagccaggtgatcgagttgctattgaaccaggagttcca
agagaaacagatgaattctgcaaaaccggtcgctataacttgtcccccaatatttttttc
tgtgctacaccacccgatgatggaaacttgtgtagatactacacacacaatgcacacttc
tgctataaacttcctgataatgtaacatttgaagaaggagctctgatagaacctctctct
gtcgggatccatgcttgtcgaagagctggggttacacttggaagccaggtctttatatgt
ggtgcaggacctattgggctggtttcactaattgttgcgaagatgatgggggcttcacaa
acggtgataagtgatttatctccatcacggctggaaaaagccaaagaagtaggagcagat
tttctccttcaaatcactaatgagactcctgaacaaatagctcgcaaagtggaagaattg
cttgggtgtatgccagagatcaccatagagtgtactggggctgaatcttgcattcagaca
ggaatttatgcaacacgctctggtgggactttaattcttgttggtttggggcctgcaatg
gtcaatgttccaattgtaaatgcagcagtgcgagaggttgatatcagagggatattccga
tattgcaatacgtggccaatggctatctctatgttggcttctaaaagagtgaatgtggct
ccattggttacacatcgctttactttagagaaggctctggatgcatttgaaactacaaag
agaggtgtaggagttaaagtaatgctgaaatgtgacaaagatgaccagagcccttaa

DBGET integrated database retrieval system