KEGG   Nanorana parkeri: 108803812Help
Entry
108803812         CDS       T04897                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
npr  Nanorana parkeri
Pathway
npr00020  Citrate cycle (TCA cycle)
npr00190  Oxidative phosphorylation
npr01100  Metabolic pathways
npr01200  Carbon metabolism
Module
npr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
npr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108803812 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108803812 (SDHA)
Enzymes [BR:npr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108803812 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 108803812
NCBI-ProteinID: XP_018431115
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MSVLSAAGLGWRRLITSRNIQRLASSAPLCRAFHFDVSGRRSARVSESISAQYPVVDHEF
DALVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEDDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTERGQIYQRAFGGQSLKYGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSFFVEYFALDLLMEDGECRGVIALCMEDG
SIHRFRAKNTVIATGGYGRTFFSCTSAHTCTGDGNAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEISETAMIFAGVDVNKEPIPVLPTVHYNMGGIPTNYKGQAIVHVGGEDQVVPGL
YACGEAASASVHGANRLGANSLLDLVVFGRACALSIAESCTPGEPLSPLKPNAGEESVSN
LDKLRFADGSTRTAELRLNMQKTMQTHAAVFRTGSVLKEGCEKLGAVNSAMDDIKTFDRG
IVWNTDLVEALELQNLMLCALQTINGAEARTESRGAHAREDYKVRVDEYDFSKPVQGQRK
KPMEEHWRKHTLSFVDKKGEVTLKYRPVIDSTLNEEDCASVPPAIRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcctgtcagcagcgggtctcggttggagaaggctgatcacctcacgcaacatc
cagcgcctggcctcctctgctccgctatgccgggccttccacttcgacgtgtccggccgg
agatcggcccgagtgtcggaatcgatctcggctcagtacccggtggtggatcacgagttc
gacgccctggtggtcggggccggcggtgccgggttacgggcagccttcgggctatcggaa
gccgggtttaacacggcctgcatcaccaagctcttccccaccagatctcacacggtggcg
gcccagggaggaatcaacgcggcgctggggaacatggaggacgacgactggcgctggcac
ttctacgacacggtgaagggttctgattggctgggagatcaggacgccatccattacatg
acggagcaggctccggcctccgtcatcgagctggagaattacggcatgccgttcagccgc
acggagcgcggtcagatctaccaacgcgccttcggaggtcagagcctgaaatacggcaag
gggggccaggcccatcgctgctgctgtgtggccgatcgtacgggacactccctactccac
accttgtacggccgatccctccgctacgacaccagcttcttcgtggaatacttcgccttg
gacctcctgatggaagacggtgaatgccgcggcgtcatcgccctgtgcatggaggacggg
tccattcaccgcttccgcgccaagaacaccgtcatcgccaccggcggctacggccgcacc
ttcttcagctgcacctcggcgcacacctgcacgggggatgggaacgccatggtgacccgg
gccggcctgccctgccaggacttggagtttgtccagttccaccccaccggcatctacggg
gccggctgcctgatcaccgaaatatccgagaccgccatgatctttgccggggtggacgtc
aacaaggagcccatccccgtcctccccacagtccactacaacatgggggggatccccacc
aactacaagggacaggccatcgtccacgtcggcggcgaggaccaggtggtgccggggctg
tacgcctgcggcgaagccgcgtccgcctccgtccacggagccaaccggctgggcgccaac
tccctcctggacctggtggtgttcgggcgtgcctgcgccctcagcatagccgagagctgc
acacccggggagcccctgtcgcccctgaaacccaacgcgggcgaggagtccgtgtccaat
ctggacaagctgaggttcgccgacggaagcaccagaaccgccgagctgaggctcaacatg
cagaagaccatgcagacgcacgccgccgtcttccgcaccggctccgtgctgaaggaaggc
tgcgagaagctcggcgccgtcaactccgccatggacgacatcaagaccttcgaccgcgga
atcgtctggaacacggacctggtggaggcgctggagttgcagaacctgatgctgtgcgcc
ctgcagaccatcaacggggccgaggcccgcacggagagccgcggggcccacgccagggag
gactacaaggtgcgggtggatgagtacgacttctccaagcccgtgcaggggcagcggaag
aaaccaatggaggagcattggaggaagcacaccttgtcctttgtggataagaagggggag
gtgaccctgaagtaccggcccgtgatcgactccacgctgaatgaagaggactgcgcctcc
gtcccccccgccatccgctcctactaa

DBGET integrated database retrieval system