KEGG   Nanorana parkeri: 108803813
Entry
108803813         CDS       T04897                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
npr  Nanorana parkeri
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 Rubis-subs-bind EF-hand_like Mst1_SARAH
Other DBs
NCBI-GeneID: 108803813
NCBI-ProteinID: XP_018431116
LinkDB
Position
Unknown
AA seq 171 aa
TRTAPVSPPPAKKPPCARERRGSANSQQVKRRTSFYLPKDASKHLHLTSRTTASEVIQAL
LRKFTVLDNPRKFALFQRTEGEGQASQRKLSDEEEPLALRLLAGPCEKTLSFLLKENETG
EVNWDAFSMPELQNFLRILQREEEEHMRQLIQRYTRCRQQMQEALAERAPG
NT seq 517 nt   +upstreamnt  +downstreamnt
aacaaggacggctcccgtgtcccccccccccgccaagaagccgccgtgtgcgcgggaacg
cagggggtcggccaactcgcagcaggtgaaacgcagaacctccttctacctccccaaaga
cgcctcgaagcacctgcacctcacctcccgcaccaccgccagcgaggtcatccaggcgct
cctccgcaagttcaccgtcctggacaacccgcgcaagttcgccttgttccagcggacgga
gggggaggggcaagcctcccagaggaagttgtcggacgaggaggagcctctggcgctgcg
tctcctggccgggccgtgcgagaagactctgagcttcctgctgaaggagaacgagaccgg
ggaggtcaattgggacgccttcagcatgccggagctgcagaacttcctgcgcatcctgca
gcgggaggaggaggagcacatgcggcagctcatccagcgctacacccgctgccgccaaca
gatgcaggaggccctggcggagcgcgcacccggctga

DBGET integrated database retrieval system