KEGG   Nanorana parkeri: 108803968
Entry
108803968         CDS       T04897                                 

Definition
(RefSeq) N-lysine methyltransferase setd6-like
  KO
K05302  N-lysine methyltransferase SETD6 [EC:2.1.1.-]
Organism
npr  Nanorana parkeri
Brite
KEGG Orthology (KO) [BR:npr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108803968
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     108803968
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108803968
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 108803968
NCBI-ProteinID: XP_018431248
LinkDB
Position
Unknown
AA seq 205 aa
EEDQAVPTHDEPDSTHHERVPARDDPVSAFLDWCTASGIHLNPKVYISTEGTVAQYGMMT
RQDLPVGEVVFTIPRPALLSQHTTRIQDLLEQERQNLDSTSGWVALLVSLMYEAMDHNSP
WAPYFGLWPQLVPPDLPMFWSEEERAELLGGTGVPDAVRKDLENIEEEYKTIVLPLIRRH
PETFRPETHTLNLYKRLAAFVMAYR
NT seq 618 nt   +upstreamnt  +downstreamnt
gaggaagaccaggcagtccccacccacgatgagccagactccacccaccatgagagagtc
cccgcccgcgatgatccagtctccgccttcctggattggtgtacagcctctggaatccac
ctgaacccaaaggtgtacatcagcacggaggggacggtggcgcagtacgggatgatgacc
cgccaggatctgccggtgggagaagtggtgttcaccatcccccgaccggctcttctgtca
cagcacacgacccgaatccaggatctgctggagcaagagcggcagaatctggacagcaca
tcaggctgggtcgccctcctcgtctccctcatgtatgaagcgatggaccacaactctcca
tgggccccgtactttgggctgtggccccagctggtccctccggaccttcccatgttttgg
tcggaggaggagagggcggagctcctggggggcaccggggtcccggacgcggtgaggaag
gatctggagaacattgaggaggaatataagacgatcgtcctcccgttaatcaggagacat
ccggagaccttccgtcccgagacacacacgctgaacctctacaagaggctggcggccttc
gtcatggcgtacaggtga

DBGET integrated database retrieval system