KEGG   Nanorana parkeri: 108803969Help
Entry
108803969         CDS       T04897                                 

Definition
(RefSeq) creatine kinase M-type
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
npr  Nanorana parkeri
Pathway
npr00330  Arginine and proline metabolism
npr01100  Metabolic pathways
Module
npr_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    108803969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npr04147]
    108803969
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     108803969
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   108803969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 108803969
NCBI-ProteinID: XP_018431249
LinkDB All DBs
Position
Unknown
AA seq 381 aa AA seqDB search
MPFGNTHNAYKLNFSSEEEYPDLSQHNNHMAKVLTPDIYKKLRDKFTPSGFTLDDLIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKDLLDKVIEDRHNGYKPTDKHKTDLNWNNLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAIENLSIKALSSLSGEFKGKYYPLKAMS
DAEQQQLIDDHFLFDKPVSPLLLAAGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QPGGNMKEVFKRFCEGLQKIEEIFKKDGHPFSWSEHLGYILTCPSNLGTGLRGGVHVKLP
NLSKHAKFEEILSRLRLQKRGTGGVDTAAVGGTFDISNADRLGFSEVEQVQMVVDGVKLM
IEMEKKLEKGQPIDDLVPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcggaaacacccacaacgcctacaagctgaacttctcctctgaggaggaatac
ccagatctctcccaacacaacaatcacatggccaaggtcctgacacccgacatctacaag
aagctgagagataagttcacccccagtggcttcaccctcgatgacctcatccagaccggt
gtggacaacccaggtcacccctttatcatgactgtgggatgtgtcgctggtgatgaggaa
tcctatgaagtcttcaaggatctgcttgacaaagtcattgaggaccgtcacaatggctac
aaacccaccgacaagcacaagaccgacctgaactggaacaacctgaagggtggagatgac
ctggacccaaactatgttctgagcagccgcgtcaggactggccgcagcatcaagggatac
accctccccccacactgcagccgcggagagcgtcgtgccattgagaatttgtccatcaaa
gctctcagcagcttgtctggagagttcaagggaaagtattaccccctgaaggccatgtca
gacgctgaacagcagcagctgattgatgatcacttcctgtttgacaagcccgtgtcccct
ctgctgctggccgctggtatggcccgtgactggcccgatgcccgtggtatctggcacaat
gacaacaagaccttccttgtgtgggtaaatgaagaggatcacctgagagtcatctccatg
cagccaggaggcaacatgaaggaggtcttcaaacgcttctgcgagggtcttcagaagatt
gaggagatcttcaagaaggatggacatcccttcagctggagcgagcatcttggttacatc
ctgacatgcccatccaacttgggtacaggtctgcgtggcggcgtccatgtgaagcttccc
aacctcagcaaacatgccaaattcgaggagatcctgtccaggctgcgtctgcagaagaga
ggcaccggtggtgtggacacagctgccgtcggtggcaccttcgatatctccaacgccgac
agattgggcttctctgaggtggaacaggtccagatggtggtggatggcgtgaagctgatg
attgagatggagaagaagctggagaagggtcagcccatcgatgacttggtgccagcccag
aagtaa

DBGET integrated database retrieval system