KEGG   Nanorana parkeri: 108804111
Entry
108804111         CDS       T04897                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04020  Calcium signaling pathway
npr04144  Endocytosis
npr04510  Focal adhesion
npr04540  Gap junction
npr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108804111 (PDGFRA)
   04020 Calcium signaling pathway
    108804111 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108804111 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108804111 (PDGFRA)
   04540 Gap junction
    108804111 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108804111 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npr01001]
    108804111 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:npr04090]
    108804111 (PDGFRA)
Enzymes [BR:npr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108804111 (PDGFRA)
Protein kinases [BR:npr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108804111 (PDGFRA)
CD molecules [BR:npr04090]
 Proteins
  108804111 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Kinase-like Herpes_gE RIFIN
Other DBs
NCBI-GeneID: 108804111
NCBI-ProteinID: XP_018431378
LinkDB
Position
Unknown
AA seq 1091 aa
MALAPRKSLILGCFLFIAPLFTYGTNPLPMIFPENDEMVVQLHHSISISCSGESELSWKY
PTEDNGDDNVDIRHEENNSGLFMSVLEVKNASAIHTGSYTCYYNHTQTDELEVEGMEMYI
YVPDPTVPFVPCAMFDHIIVVEEDDSAIVPCRTTDPNSQVTLRNKEMDKIVNAFYDSKQG
FVGNFLSSVYICETMVNGVLFITDDFNLQTWKASNNIAVEMQAPKTVYTTGETITISCIV
LDNELVDLQWNYPGKQRKSGIKKVEESKKPQLRLEYTLTIPNVTEKDSGEYECAVIFAIG
DGKEAQTVNVTVHDKGFVTLIPKFGQLEFANLHEVKSFSVEVEAYPSPKIFWLKDYVTLN
DSMTEITTTTIRNEEAKYLSRLNLIRVKEEDGGMYTLVVQNDAENKTSSFELKIKVPALI
LQLVDDHHGSSGQQTVECLAKGMPIPDVEWLVCKDIKRCNNDSSWSVLVTNGTEIMMETH
QNNENTVESQVTFKKVDETVAIRCIAKNDLGVVARELKLVAATLRSELTVAAAVLVLLVI
VIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGR
ILGSGAFGKVVEGAAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNI
VNLLAACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRQSEKLKKDLDIFGLNPVDEST
RRYENYVILSFENNGDYMDMKQVDNTQYVPMHEMNEVSKYSDIQRSWYDRPASYKKKPMS
EVKNLFSDEGFEGLTMLDLLSITYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICD
FGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPY
PGMVVDSSFYNKIKSGYRMAKPEYATHEVYDIMGKCWNSEPEKRPSFYHLSEIVESLLPA
EYKTCYEKILHDFLKSDHPAVTRMGCENDNSYIGVTYKNENKMKDRDNVFDEQRLSADSG
YIIPLPDIDPVSDDESGKRNRHSSQTSEESAIETGSSSSTIVKREDETIEDIEMMDDIGI
DSSDLVEDSFL
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcgcttgccccaaggaaatccctaattttgggatgctttctgtttattgctccactt
tttacttatggtacgaaccccttgccgatgatcttcccagagaatgatgagatggtagta
cagttacaccattccatttcaataagctgcagtggtgagagtgagctaagttggaagtat
cccactgaagataacggtgatgacaatgtagacatccggcatgaagaaaacaatagcgga
ctctttatgtcagtgctagaagtgaagaacgcgtctgccattcacacaggatcctatacc
tgctattacaatcacacccagacagatgaattggaagttgaaggcatggaaatgtacatt
tatgttccagatcccacagttccttttgttccatgtgcaatgtttgaccacattattgta
gtggaagaagatgactctgctatcgttccttgtcggacaactgatcccaacagccaagtg
accttgaggaacaaagagatggacaagattgtcaatgccttctacgacagcaagcaaggt
tttgttggcaatttcctatcaagtgtctacatttgtgaaaccatggtaaatggtgtgctc
ttcataacagatgatttcaacctacagacatggaaagcaagtaataatattgcagtggaa
atgcaagctccaaaaactgtttacactacaggtgaaaccatcaccatttcctgcattgtt
ctagacaatgagttggttgatctgcaatggaattaccccggaaagcagagaaaatctggc
attaaaaaagttgaagaaagcaagaagcctcaattgagactggaatatacactgaccatc
ccaaatgttacagaaaaggattctggggaatatgaatgtgcagtcatttttgccatagga
gacggcaaagaagcacaaacagttaacgtgacagttcacgataaaggatttgtaacactg
atccccaagtttggacagctagaatttgcaaatctccatgaagtaaaatctttttctgtg
gaggtagaggcttacccatcaccaaagatcttctggttaaaggactatgtcaccctgaat
gacagcatgactgagatcactacgaccacaatcaggaatgaggaagctaaatatttaagt
agattgaatcttatccgtgtcaaagaagaggatggcggcatgtatacacttgtagttcag
aatgatgcagaaaataaaacatcttcatttgagctgaaaattaaagttcctgctttgata
ttacaactggtggatgatcatcatggctcatctggtcagcaaactgtggagtgtctggct
aaaggaatgcccattcctgatgttgaatggttggtgtgcaaggatataaaaaggtgtaat
aatgacagctcctggtctgttttggtaaccaatggtacagaaatcatgatggagactcat
caaaacaatgagaacacagtggagagccaagtgactttcaagaaggttgatgagactgta
gcaattcggtgcatagcaaagaatgatcttggggttgttgcaagggagctgaaattggtt
gctgctactctacgctcagaactaacagtggcagctgcggtactcgttcttcttgtgatt
gtcatcatatcactcatagtcctagtcatcatatggaagcagaaacctagatatgaaatt
agatggcgtgtcattgagtctatcagcccagatggccatgagtatatatacgtagatcca
atgcaattgccctatgactcaagatgggaatttccaagagatggccttgttcttggtcga
atacttggatctggtgcctttggaaaggtagtagaaggtgccgcatatggacttagccgg
tcacagcctgtgatgaaagtagctgtgaaaatgcttaaacccactgccagatccagtgag
aaacaagctctaatgtctgaactgaaaatcatgactcaccttggacctcatctgaatata
gtcaacttgttagcagcatgcaccaagtcaggacctatttacatcattactgaatactgt
ttttatggggacctggtgaattatctgcacaagaatcgggacaactttcagagtcgacag
tcagaaaagctgaagaaagatcttgacatttttggactgaacccggttgatgagagcacc
agaaggtatgaaaactatgtaattttatcctttgaaaataatggtgattatatggacatg
aagcaggttgacaatacccagtatgttccaatgcatgagatgaacgaggtgtctaagtat
tctgacattcagaggtcctggtatgatcgtcctgcatcttacaaaaagaagcccatgtca
gaggtcaaaaacctattctcagatgaaggctttgagggtttgacgatgctggatttgctg
agcatcacctaccaagttgctcgaggcatggagttcctagcttcgaagaattgcgtacat
cgtgacttggcagctcgaaatgttctgctggcacaggggaaaatagtcaagatctgtgac
tttggtctggccagagacatcatgcatgactctaattatgtttcaaagggcagcactttt
ctcccagtaaaatggatggcaccagaaagcatctttgacaacctctatacaaccctgagt
gacgtgtggtcatttggcattcttctttgggaaatattttctcttggtggaacaccatac
ccagggatggtagtggattcttcattttataacaaaatcaaaagtggctacagaatggca
aaaccagagtatgccacccatgaagtatatgacatcatggggaagtgctggaacagcgag
ccagagaagagaccttccttctaccatctgagcgaaatagtggaaagccttctacctgca
gagtataaaacgtgctatgagaagattcttcatgacttcctgaaaagtgaccatccagct
gtaactcgtatgggttgcgaaaatgacaactcttacattggggtgacttacaagaatgag
aataaaatgaaggacagagataatgtatttgatgaacaaagactcagtgctgatagtggt
tacatcatccctcttccagatattgacccggtttcagatgatgagtcaggcaagagaaac
agacacagttctcaaacatctgaagaaagtgcaattgagactggatccagcagctcgaca
attgtcaagagagaggatgagaccattgaagacattgaaatgatggatgacattggaata
gattcttcagatctagttgaggacagttttctctag

DBGET integrated database retrieval system