KEGG   Nostoc punctiforme: Npun_F0840Help
Entry
Npun_F0840        CDS       T00713                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
npu  Nostoc punctiforme
Pathway
npu00010  Glycolysis / Gluconeogenesis
npu00053  Ascorbate and aldarate metabolism
npu00071  Fatty acid degradation
npu00280  Valine, leucine and isoleucine degradation
npu00310  Lysine degradation
npu00330  Arginine and proline metabolism
npu00340  Histidine metabolism
npu00380  Tryptophan metabolism
npu00410  beta-Alanine metabolism
npu00561  Glycerolipid metabolism
npu00620  Pyruvate metabolism
npu00625  Chloroalkane and chloroalkene degradation
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_F0840
   00053 Ascorbate and aldarate metabolism
    Npun_F0840
   00620 Pyruvate metabolism
    Npun_F0840
  Lipid metabolism
   00071 Fatty acid degradation
    Npun_F0840
   00561 Glycerolipid metabolism
    Npun_F0840
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Npun_F0840
   00310 Lysine degradation
    Npun_F0840
   00330 Arginine and proline metabolism
    Npun_F0840
   00340 Histidine metabolism
    Npun_F0840
   00380 Tryptophan metabolism
    Npun_F0840
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Npun_F0840
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Npun_F0840
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Npun_F0840
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Npun_F0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACC79578
CyanoBase: Npun_F0840
CYORF: Npun_F0840
UniProt: B2IT80
LinkDB All DBs
Position
981418..982800
Genome map
AA seq 460 aa AA seqDB search
MITTELSKIGDIIQNQREFFETGKTKDVTFRIEQLKNLKQAIIEHEQAIVEALKADLHKP
ELEIYITEIGVIKEIDYAIKHINAWTKPKKAAVSFDFFSYSAKIYPEPLGVVLIIGPWNY
PFQLIISPLVGAIAAGNCAIIKPSEIASHTSGVIAKIIAKHFDPAYIAVLEGDVEASQKL
LVEKFDHIFFTGGTAIGKIIMAAAAKYLTPVTLELGGKSPCIVDTDINLEHTVRRITWGK
FINAGQTCIAPDYLLVNKKIKKDLIDGLKKCLKEFYGDNPISSPDYARIISQKHFDRLVN
FLKDGEVIIGGENQSSERYIAPTVIDNVSSEDSVMQEEIFGPILPIIEYTDVAEAIALIN
SRPKPLALYLFSQNKNLQKRVLQETSSGGVCINDTVIQVGVSSLPFGGVGDSGIGNYHGK
ASFDTFSHNKSVLQNSFWLDLKWRYAPYEGKLPLIKKLLG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgattaccactgaattatctaagattggcgatattatccagaatcagcgagagtttttt
gaaactggtaaaactaaagatgtcacttttcgcattgaacaacttaaaaatctcaagcaa
gccataattgagcatgaacaagcaatagtcgaggcattaaaagcggatttacataaacca
gaattggagatttacattacagaaataggcgtaattaaggaaattgattatgctataaaa
catatcaatgcctggactaagcccaaaaaagcagcagtttcctttgattttttttcttac
tcagcaaaaatttatccagaacctttaggggttgttttaatcattggcccttggaactat
ccatttcagttaattatctcaccgttagtaggtgcgatcgcagccgggaattgtgcaatt
atcaagccttcagaaattgcttctcatacctctggtgtcattgctaagattattgccaaa
catttcgacccagcttatattgcagtcttagaaggagatgtggaagcaagtcaaaaacta
cttgtagaaaagttcgatcatatcttttttactggtggcacagctatcggcaaaattatc
atggcagcagcagccaaatatctcacaccagtgactttagaattgggtggtaaaagtcct
tgtatagtagatactgatattaatcttgaacacactgttagacgaataacttggggcaaa
tttattaatgctgggcaaacttgtatcgcccctgactatcttttagttaataaaaaaatc
aaaaaagatttaatagatgggctgaaaaagtgcctaaaagaattttatggtgataatcct
ataagtagtcctgattatgctagaatcatcagtcaaaaacactttgatagattggtgaat
tttctcaaagatggtgaagttatcatcggtggagaaaatcaatcttcagagcgttatatc
gctcccacagtgattgataatgtctcttcggaagattctgtaatgcaggaagagattttt
gggccaattttaccaattattgaatatactgacgttgccgaagcgatcgcgttgattaac
tctagacctaaacccctggcgttatacttattttctcaaaacaaaaacttgcaaaagcga
gttttgcaggaaacttcatctggtggggtctgcatcaatgacacagtaatacaggttggt
gtctcgtctttaccatttggtggggtaggagatagcggcattggcaactatcacggcaaa
gctagttttgacactttttcccacaacaaaagtgtattgcaaaactctttctggctcgat
ttaaaatggcgatacgctccttatgaaggcaaattgccactcataaagaaacttttgggt
taa

DBGET integrated database retrieval system