KEGG   Nostoc punctiforme: Npun_F1213Help
Entry
Npun_F1213        CDS       T00713                                 

Definition
(GenBank) small GTP-binding protein
  KO
K13730  internalin A
Organism
npu  Nostoc punctiforme
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 COR Roc LRR_1 Ras LRR_9 TIR_2 LRR_6 LRR_5 Arf Gtr1_RagA TIR MMR_HSR1 DUF1863 DUF155 MMR_HSR1_Xtn TniB AAA_16
Motif
Other DBs
NCBI-ProteinID: ACC79937
CyanoBase: Npun_F1213
CYORF: Npun_F1213
UniProt: B2IXB5
LinkDB All DBs
Position
1450968..1454525
Genome map
AA seq 1185 aa AA seqDB search
MTQKELLQLIDRAVAEGWRELDLSGQELTELPVEIGKLQQLESLILGKKVEGYERVGDHF
LEKVSGNNLKTLPLELLGLPNLRKLDISGNPLESIPDVVTQILHLEELILIRVELTEIPD
AIANLTNLTQLILSYNQITQIPEAIAKLSNLTVLIFSDNKITQIPEAIANLTNLTRLNLS
SNQITQIPEVIAKLTNLTLLYLSGNQITEIPEAIAQLTNLTLLDLSDNKITEIPEAITQS
TNLTVLDLSSNQITKIPEAIAQLTNLKLLYLSDNQITEIPEALANLTNLMQLHLSSNQIT
EIPEALANLTNLTQLYLSGNQITEIPEALANLPNLTRLYLYSNQITEIPEALANLTNLIQ
LVLFSNQIAEIPETLANLTNLIQLVLFSNQIAEIPETLAKLTNLTRLDLRFNQITQIPKV
IANLTNLTELHLSSNQITQIPEALANLTNLTQLYFSSNQITQIPGAIAKLTNLTQLDLSG
NQITEIPEAIESLSKLEKLDLRGNPLPISPEILGSSDDVGSVEDIFNYLQLLRSGEVRPL
NEAKLLLIGQGSVGKTSLIKRLIRNEYDEKQPQTDGLNVETWNVQVNSKDIRLNVWDFGG
QEIYHATHQFFLTKRSLYLLVCNCRTSEEENRIEYWLKLIESFGGESPVIIVGNKKDEQP
LDINRKALREKYPNIQEIIETSCQDNIGIDELRTAIFQQVGNLKEVYDLLPLTWFEVKQQ
LESMPQDFISYNRYIGICHENKIPEEQNQDQLIDLLHRLGLVLNFREHPILKNTNVLKPN
WVTEGIYALLSDETLKTKTKGIFTPADLTRILNSERYPTERHGYLIELMKEFELGFALEC
QPPQFLIAGLLPKDQPDKTELHGETLEFQYHYKVLPESIISRFIVKTHEKIHNQIYWRSG
VMLQYQENNEIYNIARIKADPEDKKIFITISERQETRRLFLGILRDVFQKIHKSLPNLEI
TEWVPVPNHPKHPPLDYQELLGLESMGESTVIIGKLKLKLDLRQLLDGYEDIRTRQRQQI
DKGIIEPFPIKEKIMSESIRNQIFVSYSHQDAKWLAELQKQLKPYIRAEGLIVWDDTKIK
PGAEWKAEIEKALATAKIAILLVSPNFIASDFIDRHELPPLLNAAEQEGLTIIWIPISAS
SYRKTEIEKYQAAHPSNKPLDSLSKGERNQAWVKICEEVEEAINS
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaaagagttattgcaactgatagatcgtgccgtggctgagggttggcgagag
ttagacttgtcggggcaagagttgactgagttacctgtggaaattggtaagttgcagcag
cttgagtctttgattttgggaaagaaggttgaaggttatgaacgagtaggagaccacttt
ctcgaaaaggtttcgggcaacaatttaaaaacgcttccactggaactattgggtttgcct
aatttgcgtaagttggatattagtggcaatcctttagagagcattcccgatgtggtaacg
caaatactgcatttagaggaacttatcttaattcgagtagagctaactgaaatacctgat
gcgatcgctaatttaaccaatctgacgcagcttatcctcagttacaaccaaataacccag
attccagaggcgatcgctaaattaagcaatctgactgtgcttatcttcagtgacaacaaa
ataacccagattccagaggcgatcgctaatttaaccaatctgacgcgacttaacctcagt
tccaaccaaataacccagattccagaggtgatcgctaaattaaccaatctgacgctgctt
tacctcagtggcaatcaaattactgagataccagaggcgatcgcgcaattaaccaatctg
acgctgcttgacctcagtgacaacaaaataaccgagattccagaggcgatcacgcaatca
accaatctgacggtgcttgacctcagtagcaaccaaattactaagataccagaggcgatc
gcacaattaaccaatctgaagctgctttacctcagtgacaaccaaattactgagatacca
gaggcgctcgctaatttaaccaatctgatgcagcttcacctcagtagcaaccaaattact
gagataccagaggcgctcgctaatttaaccaatctgacgcagctttacctcagtggcaac
caaattaccgagattccagaggcgctcgctaatttacccaatctgacgcggctttacctc
tatagcaaccaaattactgagataccagaggcgctcgctaatttaaccaatctgatccaa
cttgtcctcttttccaaccaaattgccgagattccagagacgctcgctaatttaaccaat
ctgatccaacttgtcctcttttccaaccaaattgccgagattccagagacgctcgctaaa
ttaaccaatctgacgcggcttgacctcagattcaaccaaataacccagattccaaaggtg
atcgctaatttaaccaatctgacagaacttcacctcagtagtaaccaaataacccagatt
ccagaggcgctcgctaatttaaccaatctgacacagctttacttcagttccaaccaaata
acccagattccaggggcgatcgctaagttaaccaatttgacgcagcttgacctcagtggc
aaccaaattaccgagattccagaggcgattgaaagtttgtcgaaattggaaaaactagat
ttacggggaaatccgcttcctatttcaccagagattttaggatcttctgatgatgttggt
tcagttgaagatattttcaattacttgcaattactccgtagcggtgaagtgcgtccactc
aacgaagccaaactcttgctcatcggacaaggcagcgtcggcaaaacatctctcatcaag
cgactaatccgcaatgaatatgatgagaaacaaccccaaaccgacggactcaatgtagaa
acttggaacgtgcaggtcaatagcaaagacatccgcctgaatgtttgggactttggcgga
caggaaatttatcatgccactcatcagttttttctaactaagcgcagcctctatctctta
gtctgtaattgtcgcaccagcgaagaagaaaaccgcatcgaatattggctgaaactaatc
gaaagcttcggcggagagtcccccgtgattatcgttggcaacaaaaaagacgaacaaccc
ttggacataaaccgcaaggcattacgcgaaaaatatcctaacatccaagagattatcgaa
acctcctgccaagataatatcggcattgatgaacttcgcaccgccattttccagcaagtc
ggcaacctcaaagaagtctacgatcttctacccctgacatggtttgaggttaaacaacaa
ctcgaatccatgccccaagacttcatcagctacaaccgctacatcggcatctgccacgaa
aacaaaattcctgaagaacaaaaccaagatcaactcatcgatctcctccatcggcttggc
ttagttctcaacttccgcgagcatcccatcctcaaaaataccaacgtcctcaaacccaac
tgggtgacagaaggcatttacgcgctcctgagcgatgaaacccttaaaactaaaaccaaa
ggtattttcacccctgccgatctcacccgcatcctcaattcagagcgctacccgaccgaa
cgtcatggttatctgatcgaactaatgaaggaattcgagcttggctttgcactagaatgt
cagccaccacaatttctgattgcgggacttctgcctaaagaccaaccagacaaaacagaa
ctccacggcgaaaccctggaatttcaataccattacaaagttctccccgaaagcatcatc
tcccgcttcatcgtcaaaacccacgaaaaaattcataaccaaatctattggcgcagtggc
gtaatgctgcaatatcaagaaaacaacgaaatctacaacattgctcggatcaaagccgat
cccgaagacaaaaaaatcttcatcactattagcgaacgccaagaaacccgccgcttattt
ctcggcatcctccgcgatgtcttccaaaaaatccacaaaagtctccccaatctcgaaatc
accgaatgggttcccgtccccaaccatcccaaacatccacccctcgactaccaagaactc
ctcggactcgaatcaatgggtgaaagtacagtcatcatcggcaaactaaaattaaaactc
gatttgcgtcaactacttgatgggtatgaagatataagaactcgacaaagacaacaaata
gacaaaggaattattgaaccattccccattaaggaaaaaattatgtccgaaagtatcaga
aaccaaatatttgttagctacagtcatcaagatgcaaaatggttagcagaactgcaaaaa
caactaaaaccctatattcgtgcagaaggtttgatcgtttgggatgacaccaaaatcaaa
cctggcgcagaatggaaagccgagattgaaaaagcattagccacggctaagattgctatc
ctgctagtcagccctaactttatagcctctgatttcatcgacagacatgaacttcccccc
ttactcaacgcagccgaacaagagggattaacaattatctggattccaattagtgcaagc
tcatatagaaaaaccgagatcgaaaaataccaagctgctcacccttcaaataaacccctc
gacagtctaagtaagggagaacgtaaccaagcttgggtgaaaatttgcgaagaagtcgaa
gaggcaataaattcataa

DBGET integrated database retrieval system