KEGG   Nostoc punctiforme: Npun_F4195Help
Entry
Npun_F4195        CDS       T00713                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, large chain RbcL
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
npu  Nostoc punctiforme
Pathway
npu00630  Glyoxylate and dicarboxylate metabolism
npu00710  Carbon fixation in photosynthetic organisms
npu01100  Metabolic pathways
npu01120  Microbial metabolism in diverse environments
npu01200  Carbon metabolism
Module
npu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
npu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
npu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Npun_F4195
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_F4195
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Npun_F4195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACC82570
CyanoBase: Npun_F4195
CYORF: Npun_F4195
UniProt: B2J8T2
LinkDB All DBs
Position
5263600..5265030
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQSKSGYQAGVKDYRLTYYTPDYTPKDTDLLAAFRMTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICYVAYPLDLFEEGSVTNVLTS
IVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVAEAINKAQAETGEIKGHY
LNVTAPTCEQMLQRAEYAKELKQPIIMHDYLTAGFTANTTLARWCRDNGILLHIHRAMHA
VIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYIEQDKS
RGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEAVVQARNEGRNLAREGNDIIREAAKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagagcaagtctgggtatcaagccggggttaaagat
tacagactaacttattacacacccgattacacaccaaaagataccgatcttctagctgcg
ttccgcatgacaccccagcctggtgttcctcccgaagaagcaggtgcggctgtagcggct
gagtcttccacaggtacttggacaactgtgtggacagacttgctcaccgacctcgatcgc
tacaaaggtcgttgttatgacatcgaaccagttcccggcgaagacaaccagtacatctgc
tacgttgcttatcctttggacttgtttgaagaaggttctgtaaccaacgtattaacctca
attgtaggtaacgtatttggtttcaaagctctgcgggcacttcgtctagaagatatccgt
ttcccagtagcttatatcaagaccttccaagggcctccacacggtatccaagttgagcgc
gacaagttaaacaaatacggtcgtcctttgctgggttgtaccattaagcccaaattgggt
ctttccgctaagaactacggacgcgctgtatacgagtgcttacgcggtggtttggacttc
accaaagacgacgaaaacatcaactccgcaccattccaaagatggcgcgatcgcttcttg
ttcgtagctgaagctatcaacaaggctcaagcagaaacaggtgaaatcaaaggtcactac
ctcaacgtcaccgctcctacttgcgaacaaatgttgcaacgggctgagtacgctaaagaa
ctcaaacagcccatcatcatgcatgactacctgaccgcaggtttcaccgccaacaccaca
ttggctcgttggtgccgtgataacggtatcttgctgcacattcaccgtgcaatgcacgct
gtaattgaccgtcaaaagaaccacggtatccacttccgtgtattggctaaagccctacgt
ttgtctggtggtgaccacatccacaccggcaccgtagttggtaagttggaaggtgagcgc
ggcatcacaatgggcttcgttgacctgttgcgtgaaaactacattgagcaagacaagtct
cgtggtatttactttacccaagactgggcttctctacctggtgtaatggcagttgcttct
ggtggtatccacgtatggcacatgcccgcgctagtagaaatctttggtgatgactccgta
ctacaattcggtggtggtactctgggacacccttggggtaatgctcctggtgctacagct
aaccgcgtcgccttggaagctgttgttcaagctcgtaacgaaggccgtaacttggctcgt
gaaggtaacgatattatccgcgaagctgccaagtggtctcctgaactagctgttgcttgc
gaactgtggaaagaaatcaagttcgagtttgaagcaatggataccgtctga

DBGET integrated database retrieval system