KEGG   Nostoc punctiforme: Npun_F5122Help
Entry
Npun_F5122        CDS       T00713                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
npu  Nostoc punctiforme
Pathway
npu00500  Starch and sucrose metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Npun_F5122
Enzymes [BR:npu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Npun_F5122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ACC83456
CyanoBase: Npun_F5122
CYORF: Npun_F5122
UniProt: B2J270
LinkDB All DBs
Position
6341349..6343913
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPPRLEPLRRLAYNLHWDWNVESKDLFRRLDSDLWESSHHNPVLMLGT
ISQSRLLEVVEDEGFLAQMDRADRQLDDYLQERTWYQKQREDKPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYLLNDFYNM
PLHLERNADGSELRIAVDYPGRKVYARVWRVQVGTVPLYLLDTNIEPNNTYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGLKVTAYHMNEGHAAFSALERIRLLIQEEGLSYAQ
AKQVVASSNIFTTHTPVPAGIDLFAPDKMLHYLGYYAEIFGLPKEQFLGLGRENTGDLSG
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWQKVPVEEVPIAAITNGVHARSCVAKS
TQELYDRYLGPNWSSAPPDSPLWERMDAIPDEELWRNHERCRLDMILYVREHLVKHLTDR
GASASEITQAQEVLDPYAFTIGFARRFATYKRATLWMRDLDRIKRLLLANKDRKVQFVIA
GKAHPKDIPGKELIREINHFIREQHLEKQVVFVPNYDIHISRLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYDDPNYQDEVEANALYELL
EKDVVPLFYDHRDTDGLPRPWVAKMKDAIRLNCPFFNTARMVGEYAQRAYFPASDRYHTL
TVDNYAPAKELAAWKEKLGEHWFNIRIKDVDVSAASDIEVNQTVAVKAKVDLATLTNDDV
QVELYQGAIDANGEIVNAVTVVMDYQGEDSQQLSIYTGNITYTASGLQGLSLRVLPKNQN
LANAYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgtacatttaacgtatccccttcactaccaccgcgactcgaaccactg
cggcggttagcatataacttgcactgggattggaatgttgagagcaaagatttatttcgt
cgcttagactctgacctatgggagtctagccatcacaatccagtgttgatgctcggtact
atctcgcaatcgcggcttttggaagttgtcgaagatgaaggctttctagcgcaaatggat
cgagctgaccgtcagttagacgattatttgcaagaacgcacttggtatcaaaaacaacgg
gaagacaaaccaaaagaatgctacgcctatttttcggcggaatttggacttgttgattgt
ttacccgtgtattctggcggcttaggcgttctggctggggatcacctcaaatctgctagt
gacttggggctaccgcttgtcggtgtaggtttgctgtatcagcaaggctactttgcccag
tatctgaatgctgatggctggcagcaagaacgctacttgctcaatgatttttataatatg
cccttgcatctagagcgtaatgccgatggttcagagctacggattgcggtagattatcca
ggacgcaaggtatacgctagagtttggcgcgtacaggtgggaactgttcccttgtatctg
cttgacaccaatattgaacccaacaacacttacgaccacgacattacagatcagctgtat
ggtggcgacatcgatatgcgtatccaccaggaaatcatgctggggatcggtggtgtgcaa
atgctcaaagctttggggctgaaagtcaccgcttaccacatgaatgaaggccacgccgcc
ttctctgccctagaacgcatccgcttgctgattcaggaagaagggctgagttatgcccaa
gctaaacaggtggtggcttccagtaatatctttactactcacacgccagtaccagcaggg
attgacttattcgctcccgacaaaatgctgcactacttggggtactatgcagagatattt
gggttgcccaaagagcaatttttaggactggggcgcgagaatacaggtgatttatctggg
cctttcagtatggcggtgctggctttgaaaatggcaacattttctaacggtgttgcacaa
ctccacggggtagtgtcgcggcaaatgttccagggcttgtggcagaaagtaccagtagaa
gaagtgccgatcgcagcaattactaatggtgtccatgctcggagttgtgtggcgaaatcg
actcaagagttatacgatcgctacctcggcccaaattggtcatcagcaccaccagatagc
ccattgtgggagcggatggacgctatacccgatgaagaattgtggcgcaatcacgaacgc
tgccgcttagatatgattttgtatgtgcgggagcatttggtcaagcatttaaccgatcgc
ggcgcttctgcttccgaaattacccaagcccaagaagttttagatccttacgctttcact
attggctttgcccgtcgctttgccacctacaaacgggctaccctctggatgcgcgatctg
gatcggattaagcggcttctgctagctaacaaagaccggaaagtgcaatttgtgattgct
ggtaaggcacatcccaaggatattcccggtaaagaactcatccgcgagatcaatcacttt
atccgcgaacaacatttagaaaaacaggtagtgtttgttcccaattacgacattcacata
tcccggttgatggttgcgggttgcgatatctggttaaatacaccgcgtcgtccacgggaa
gcctctggtactagcgggatgaaagcggcaatgaatggattgccaaatttaagtgtacta
gacggttggtgggatgaagctgattacgtccgcacgggctgggcgattggacatggagag
aattacgacgatcctaactatcaggatgaagtagaagcaaatgctctctacgagttatta
gagaaggatgttgtaccactattttacgatcaccgagatactgatggcttgccccgtccg
tgggttgccaaaatgaaggatgcaattcggttgaattgtcctttctttaacacagcgcgg
atggtaggagagtatgcacaaagagcttatttcccggctagcgatcgctatcataccctg
actgttgataactatgccccagccaaagaactagccgcttggaaagaaaaactgggcgaa
cactggtttaacatcagaatcaaagatgttgatgtatcggcagcttcagacattgaagtt
aaccaaactgttgctgtcaaagccaaagttgacttagcaaccttgaccaatgatgatgtg
caggtggagttatatcaaggtgcgatcgatgccaatggcgagattgtcaacgctgtaaca
gtggtgatggattaccaaggtgaggattcacagcaattgagtatttacactggtaatatc
acttataccgcttctggtttgcaaggtttgtctttacgtgtattgccgaaaaatcaaaat
ctggctaatgcttatgaaccaaggttgattgcttgggcagagtaa

DBGET integrated database retrieval system