KEGG   Nostoc punctiforme: Npun_F5597Help
Entry
Npun_F5597        CDS       T00713                                 

Definition
(GenBank) D-alanine--D-alanine ligase domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
npu  Nostoc punctiforme
Pathway
npu00473  D-Alanine metabolism
npu00550  Peptidoglycan biosynthesis
npu01100  Metabolic pathways
npu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Npun_F5597
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Npun_F5597
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Npun_F5597
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:npu01011]
    Npun_F5597
Enzymes [BR:npu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Npun_F5597
Peptidoglycan biosynthesis and degradation proteins [BR:npu01011]
 Precursor biosynthesis
  Amino acid ligase
   Npun_F5597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK TTL
Motif
Other DBs
NCBI-ProteinID: ACC83902
CyanoBase: Npun_F5597
CYORF: Npun_F5597
UniProt: B2J6X6
LinkDB All DBs
Position
6909563..6910609
Genome map
AA seq 348 aa AA seqDB search
MPVLNILHLVGSAHDKFYCDLSRLYAQDCLAATADPSLYNFQIAYITPDRQWRFPDSLSR
EDIALTKPIPVFDAIQFLTGQNIDMMLPQMFCIPGMTQYRALFDLLKIPYIGNTPDIMAI
AAHKARAKAIVEAAGVKVPRGELLRQGDIPTITPPAVVKPVSSDNSLGVVLVKDVTEYDA
ALKKAFEYASEVIVEAFIELGREVRCGIIVKDGELIGLPLEEYLVDPHDKPIRNYADKLQ
QTDDGDLHLTAKDNIKAWILDPNDPITQKVQQVAKRCHQALGCRHYSLFDFRIDPKGQPW
FLEAGLYCSFAPKSVISSMAKAAGIPLNDLLITAINETLGSNKKVLQN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccagtacttaatatccttcatttagttgggtctgcacacgataagttttactgtgat
ttatcacgtctttatgcccaagactgtttagctgcaacagcagatccatcgctttataac
tttcaaattgcatatatcacacccgatcggcagtggcgatttcctgactctctcagtcga
gaagatattgctcttaccaaaccgattcctgtgtttgatgccatacaatttctaacaggc
caaaacattgacatgatgttaccacaaatgttttgtattcctggaatgactcagtaccgt
gccctattcgatctgctcaagatcccttatataggaaataccccagatattatggcgatc
gcggcccacaaagccagagccaaagcaattgtcgaagcagcaggggtaaaagtgcctcgt
ggagaattgcttcgccaaggagatattccaacaattacacctccagcagtcgtcaaacct
gtaagttctgacaactctttaggagtagtcttagttaaagatgtgactgaatatgatgct
gccttaaagaaagcatttgaatatgcttcggaggtcatcgtagaagcattcatcgaactt
ggtcgagaagtcagatgcggcatcattgtaaaagacggtgagctaataggtttacccctt
gaagagtatctggtagacccacacgataaacctatccgtaactatgctgataaactccaa
caaactgacgatggcgacttgcatttgactgctaaagataatatcaaggcttggatttta
gaccctaacgacccaatcacccaaaaggttcagcaagtggctaaaaggtgtcatcaggct
ttgggttgtcgccactacagtttatttgacttccgaatcgatccaaagggacaaccttgg
ttcttagaagctggattatattgttcttttgcccccaaaagtgtgatttcttctatggcg
aaagcagccggaatccctctaaatgatttattaataaccgctattaatgaaacattgggt
agtaataaaaaggtgttacaaaattga

DBGET integrated database retrieval system