KEGG   Nostoc punctiforme: Npun_F6414Help
Entry
Npun_F6414        CDS       T00713                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
npu  Nostoc punctiforme
Pathway
npu00010  Glycolysis / Gluconeogenesis
npu00020  Citrate cycle (TCA cycle)
npu00620  Pyruvate metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01130  Biosynthesis of antibiotics
npu01200  Carbon metabolism
Module
npu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_F6414
   00020 Citrate cycle (TCA cycle)
    Npun_F6414
   00620 Pyruvate metabolism
    Npun_F6414
Enzymes [BR:npu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Npun_F6414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL
Motif
Other DBs
NCBI-ProteinID: ACC84686
CyanoBase: Npun_F6414
CYORF: Npun_F6414
UniProt: B2IY87
LinkDB All DBs
Position
7924732..7926033
Genome map
AA seq 433 aa AA seqDB search
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHI
IVEAGETAPVGSAIAFIAETEAEIEQAKSLANSGGVAATTTSAPEPIPATASVVTPALAS
QNGSNHKEGRLVASPRARKLAKELKVDLTTLQGSGPYGRIVAEDVEALSNKGKQPATAPV
APPATVPTSAPIASPAPRTPAPAPVVAAVPGQIVPLTTFQNAVVRNMVATISVPVFRVGY
TITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVAV
AMDDGGLITPVLQNADAVDIYSLSRTWKSLVERARAKQLQPQEYNSGTFTLSNLGMFGVD
KFDAILPPGQGSILAIGASRPQVVATPDGLFGVRQQMQVNITSDHRIIYGAHAAAFLQDL
AKLIETNPQSLTL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcatgaagtatttatgccggcgctgagttccaccatgacggaaggcaaaatc
gtctcctgggtaaaatcgccaggggacaaagtggaaaaaggcgaaacagtggtggttgta
gagtcagataaggcagatatggatgtagaaaccttttatgaaggctttcttgcccatatc
atagttgaagctggtgaaactgccccggtaggatctgcgatcgccttcatagccgaaact
gaagctgaaattgaacaggccaaatctcttgccaattccggcggcgtggctgctactact
acctctgcccctgagccaatccccgccacagcctcagttgtaacacctgccttagcgtct
caaaatggctctaatcacaaagaaggcagacttgtagcttcaccccgtgcccgcaaatta
gccaaagaactcaaagttgatttaactacactccaaggcagtggtccctacggtcgcatt
gtcgccgaagatgtagaagcattgtccaataagggcaaacaacccgccactgccccagtt
gccccaccagcaactgtaccaaccagcgccccaattgcatccccagcacctcgcacacca
gcacccgcgccagtggtagctgctgttcctggtcaaatcgtacctctaactaccttccaa
aatgccgtagtgcggaacatggtagccaccatatccgtgcccgtcttccgcgtcggttat
acaattaccactgacggattagacaaactttataaacaaattaaatccaaaggcgtgaca
atgacagcgctactggcgaaagctgtagcagtgacattgcaaaaacacccattgttaaat
gctagctattcagaccagggtattgtttatcattctgatatcaacatttccgtagccgta
gcgatggatgatggcggattaattacacctgtgttgcaaaatgcagatgcagtggatatt
tattctctatcgcgtacttggaagtctttggtagaacgtgccagagcaaaacaactacaa
ccccaagaatacaacagtggtacttttaccctatctaatttggggatgtttggcgtagac
aaatttgatgcgattttgccgcctggacaaggttcaattttagcgatcggggcatcccgt
ccgcaagtggtagcaacacccgacggtttatttggcgtgcgtcaacaaatgcaagtcaat
attacttctgaccaccggattatttacggtgcccatgctgcggcgttcttgcaagattta
gcgaaattgattgagacaaatcctcaatctttgacactgtag

DBGET integrated database retrieval system