KEGG   Nostoc punctiforme: Npun_F6414
Entry
Npun_F6414        CDS       T00713                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
npu  Nostoc punctiforme
Pathway
npu00010  Glycolysis / Gluconeogenesis
npu00020  Citrate cycle (TCA cycle)
npu00620  Pyruvate metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01200  Carbon metabolism
Module
npu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_F6414
   00020 Citrate cycle (TCA cycle)
    Npun_F6414
   00620 Pyruvate metabolism
    Npun_F6414
Enzymes [BR:npu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Npun_F6414
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL
Other DBs
NCBI-ProteinID: ACC84686
CyanoBase: Npun_F6414
CYORF: Npun_F6414
UniProt: B2IY87
LinkDB
Position
7924732..7926033
AA seq 433 aa
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHI
IVEAGETAPVGSAIAFIAETEAEIEQAKSLANSGGVAATTTSAPEPIPATASVVTPALAS
QNGSNHKEGRLVASPRARKLAKELKVDLTTLQGSGPYGRIVAEDVEALSNKGKQPATAPV
APPATVPTSAPIASPAPRTPAPAPVVAAVPGQIVPLTTFQNAVVRNMVATISVPVFRVGY
TITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVAV
AMDDGGLITPVLQNADAVDIYSLSRTWKSLVERARAKQLQPQEYNSGTFTLSNLGMFGVD
KFDAILPPGQGSILAIGASRPQVVATPDGLFGVRQQMQVNITSDHRIIYGAHAAAFLQDL
AKLIETNPQSLTL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagcattcatgaagtatttatgccggcgctgagttccaccatgacggaaggcaaaatc
gtctcctgggtaaaatcgccaggggacaaagtggaaaaaggcgaaacagtggtggttgta
gagtcagataaggcagatatggatgtagaaaccttttatgaaggctttcttgcccatatc
atagttgaagctggtgaaactgccccggtaggatctgcgatcgccttcatagccgaaact
gaagctgaaattgaacaggccaaatctcttgccaattccggcggcgtggctgctactact
acctctgcccctgagccaatccccgccacagcctcagttgtaacacctgccttagcgtct
caaaatggctctaatcacaaagaaggcagacttgtagcttcaccccgtgcccgcaaatta
gccaaagaactcaaagttgatttaactacactccaaggcagtggtccctacggtcgcatt
gtcgccgaagatgtagaagcattgtccaataagggcaaacaacccgccactgccccagtt
gccccaccagcaactgtaccaaccagcgccccaattgcatccccagcacctcgcacacca
gcacccgcgccagtggtagctgctgttcctggtcaaatcgtacctctaactaccttccaa
aatgccgtagtgcggaacatggtagccaccatatccgtgcccgtcttccgcgtcggttat
acaattaccactgacggattagacaaactttataaacaaattaaatccaaaggcgtgaca
atgacagcgctactggcgaaagctgtagcagtgacattgcaaaaacacccattgttaaat
gctagctattcagaccagggtattgtttatcattctgatatcaacatttccgtagccgta
gcgatggatgatggcggattaattacacctgtgttgcaaaatgcagatgcagtggatatt
tattctctatcgcgtacttggaagtctttggtagaacgtgccagagcaaaacaactacaa
ccccaagaatacaacagtggtacttttaccctatctaatttggggatgtttggcgtagac
aaatttgatgcgattttgccgcctggacaaggttcaattttagcgatcggggcatcccgt
ccgcaagtggtagcaacacccgacggtttatttggcgtgcgtcaacaaatgcaagtcaat
attacttctgaccaccggattatttacggtgcccatgctgcggcgttcttgcaagattta
gcgaaattgattgagacaaatcctcaatctttgacactgtag

DBGET integrated database retrieval system