KEGG   Nostoc punctiforme: Npun_R1308Help
Entry
Npun_R1308        CDS       T00713                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
npu  Nostoc punctiforme
Pathway
npu00970  Aminoacyl-tRNA biosynthesis
npu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Npun_R1308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:npu03029]
    Npun_R1308
Enzymes [BR:npu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Npun_R1308
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Npun_R1308
Mitochondrial biogenesis [BR:npu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Npun_R1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACC80024
CyanoBase: Npun_R1308
CYORF: Npun_R1308
UniProt: B2IYD7
LinkDB All DBs
Position
complement(1586692..1588152)
Genome map
AA seq 486 aa AA seqDB search
MASIRELHQQLVKKERSAVEITQEALERIEALEPKLHSFLCVTAERALEQAGAVDAKIAA
GEEIGLLAGIPVGIKDNLCTKGIPTTCASRILENFVPPYESTATQKLADAGAVMVGKTNL
DEFAMGSSTENSAYQVTANPWNLSRVPGGSSGGSAAAVSSQECVVALGSDTGGSIRQPAS
FCGVVGMKPTYGLVSRYGLVAYASSLDQIGPFANTVEDAAILLNAIAGHDPKDSTSLKVA
IPNYAASFKPDFKPRGQLRIGIVKETFGEGLDSVVEQAVTKAVDVLQSLGAEIHIISCPR
FRYGLPTYYIIAPSEASANLARYDGVKYGYRAPDADNLLSMYTRTRATGFGTEVKRRIMI
GTYALSAGYYDAYYLKAQKVRTLIKEDFEKAFRVVDVLVCPTSPTTAFKAGEKTTDPLSM
YLTDLMTIPVNLAGLPSLSLPCGFDDQGLPIGLQLIGNVLREDQLFQVAYAYEQATTWHL
RKPQIS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcatccatccgcgagttgcaccaacaactagttaaaaaagaacgttctgccgttgaa
attacccaagaagctttagagcgcattgaagcgttagagccgaaattacatagcttttta
tgtgttaccgcagaacgggcattagagcaggcgggtgctgtggatgccaaaattgctgcc
ggagaagaaatcgggctactagcaggcattcctgttgggattaaggacaatttatgtact
aagggaatccctaccacttgcgcctcccgaattttagagaattttgtgccgccttatgaa
tcaacggcgacgcaaaagctggcagatgctggggccgtaatggtaggcaaaaccaactta
gatgagtttgcaatgggtagttccacagaaaactctgcctaccaagtcacggctaatccc
tggaatttgtcacgagttccaggtggttcttcggggggttcggctgcggcggtgtcatcc
caagaatgtgtagttgctctcggttctgatactggcggttcgattcggcaaccggcatct
ttctgcggtgtggtggggatgaaaccaacttatggtttggtttctcgttatggtttggtg
gcttacgcttcgtctttggatcaaattgggccatttgccaacacagtagaagatgcggca
atattattaaatgcgatcgcaggtcacgatcccaaagactctaccagcctcaaagttgcc
attcccaactacgccgccagcttcaaaccagacttcaaacccagaggtcagctaagaatt
gggatcgttaaagaaacttttggtgaaggtttagactctgtagtggaacaagctgttacc
aaagcagtagatgtattacaaagtttgggagcggagattcatataatttcctgtccgcgc
tttcgttatggcttacccacctactacatcattgccccatccgaagcatcagcaaacttg
gctcgttacgatggcgttaaatatggctaccgcgctcctgatgccgataacctactatcg
atgtatactcgtacccgtgccactggttttggtacagaagtcaaacgtcggattatgatc
ggcacttatgccctttctgctggctattacgatgcttattacctgaaagcgcaaaaagtc
cgcaccctaattaaagaagactttgaaaaggcttttcgcgtagttgatgtgttagtttgt
cccacatctcccactacagcattcaaagcaggggaaaaaactactgatcccttgagcatg
tatttaactgacttgatgactattcctgtgaatcttgctggtttacctagtttaagtttg
ccatgtggttttgatgaccagggtttaccaataggattacagctaattggcaatgtactg
cgagaagaccaattgtttcaggtagcttacgcttatgaacaagctactacttggcatctg
cgtaaaccacaaatatcttga

DBGET integrated database retrieval system