KEGG   Nostoc punctiforme: Npun_R2355Help
Entry
Npun_R2355        CDS       T00713                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K11951  bicarbonate transport system permease protein
Organism
npu  Nostoc punctiforme
Pathway
npu02010  ABC transporters
Module
npu_M00321  Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:npu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Npun_R2355
Transporters [BR:npu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    Npun_R2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACC80923
CyanoBase: Npun_R2355
CYORF: Npun_R2355
UniProt: B2J8E6
LinkDB All DBs
Position
complement(2904823..2905662)
Genome map
AA seq 279 aa AA seqDB search
MTIAQKRPANPRLNNSFISGLQKQFPDLIPPAIAISIFLVLWQLFAWVPGATLPGPIQVI
QDTWVLIFWPFYDRGGIDKGLFWQILASLQRVAISYTLAAIVGIGLGVLIGVNKTMSKAL
DPIFQLLRTVPPLAWVPISLAALRQNEPAALFVIFITAIWPILINTAVGVTQIPQDYNNV
AKVLQLSRKEYFTNILIPSALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGFFIWDAY
QNNNVSEVILALVYIGVVGLLLDKAMGWLQNKILPAEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagctcaaaaacgccctgcaaaccctagattgaataatagctttatttccggt
ctgcaaaagcaatttcctgacctgataccaccagcgatcgccatctcaattttcctcgtt
ctctggcaactcttcgcttgggttccgggagctacattaccaggcccaatacaagttatc
caagacacttgggttttgattttctggccattttatgaccgaggtggtattgataaaggt
ctgttttggcagattctcgctagtctgcaacgagttgccattagttataccctagctgca
atcgttggtattggcttgggtgttttgattggtgtcaataaaaccatgtccaaagcttta
gatcccatttttcaactactgcgaactgtaccacccctagcttgggtacctatttcttta
gcagctttaagacaaaacgaaccagctgccttattcgtaattttcattactgcaatttgg
cccatattaattaacactgctgtcggcgttacccaaattccccaagattacaacaacgtc
gccaaagttctgcaacttagccgcaaagaatatttcactaatattttgataccttcggca
ttaccatacatatttactggcttgagaattgcaatcggtctagcttggttagcaattatc
gccgcagaaatcgtcatgtccggtattgttggaatcggcttctttatctgggatgcctat
caaaataacaacgtcagcgaagtaattttagctctagtttatatcggcgttgttgggttg
ctcttagataaagcgatgggttggctgcaaaacaagattttaccagcagaacagaaatag

DBGET integrated database retrieval system