KEGG   Nostoc punctiforme: Npun_R3102Help
Entry
Npun_R3102        CDS       T00713                                 

Definition
(GenBank) glycoside hydrolase 15-related
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
npu  Nostoc punctiforme
Pathway
npu00500  Starch and sucrose metabolism
npu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Npun_R3102
Enzymes [BR:npu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Npun_R3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ACC81583
CyanoBase: Npun_R3102
CYORF: Npun_R3102
UniProt: B2IXQ5
LinkDB All DBs
Position
complement(3858381..3860774)
Genome map
AA seq 797 aa AA seqDB search
MKILSQGQAFGSPGIDPQWTHANKDGVGTAYSTSSRVWFTVWNGVVTEIYHPTVDRPQVR
DLQYLISDGKSFFHEEKRHLESKVEPMWIHGLGYRITNSDPQGRYAVIKEVIADPHLSCI
LQHTKLTGDSDFISQLQLYALCAPHLEVGGRGNNGYAVQVAGHRILTAEKAGTWLALSAT
VPFTRLSCGYVGQSDGWTDLADNFRMDWEFDSAVDGNLALTGKLNLNGSKEFTLGLAFGT
TLHNAISTLFQSLNIPFEKQKQQYNEQWKRSRDGIHSLENASYDDGKLYHNSVSLLLAHE
DKSYPGALIASMAIPWGEAKDDQDQGGYHLVWTRDLVSSVTGLVAAGETDTAVRSLIYLA
TSQQEDGGFAQNFWVDGEPYWKGIQLDEVAFPILLAWILHQEKVPLHFDIYPMILRAAGY
LIRHGPATQQERWEENSGYSPSTLASNIAALICAAQFVRESGDEATAQFIEEYADFLESH
IEAWTVTTEGTLVPGIKRHYIRITPTNINNPQPNENPNQGTLLIASQPPGEPAEFPAKEI
VDGGFLQLVRYGIRKPDDPIIVDSVKVIDAILKVDTPVGPCWHRYNHDCYGQQEDGSPYI
GYGKGHAWPLLTGERGHYELAAGGDVKTYIKVVEGFASNTCLLPEQVWDEADRPDIHQYL
GKPTGSAMPLMWAHAEYIKLLRSNHDGQVFDFIPEVANRYLGERKQCKSLEIWKFNRQID
KVKKGYTLRIHALASFQLHWSDDNWQTVKDTPSTSTKLGVNFVDISVSDNQQQPIIFTFF
WIDTSKWEQRNYTVAVS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttagtcaaggacaggcttttggttcacctggcatcgatcctcaatggact
catgccaataaagatggagtaggaacagcttactctacctccagtcgcgtttggtttact
gtctggaacggtgttgtgactgaaatctaccaccccacagtagacagaccccaagttcgg
gatttacagtatctcatttctgatggtaaaagctttttccacgaagagaaacgccatctc
gaatcaaaagtagaaccgatgtggattcatggtttaggatatcgcatcactaattccgat
ccccaagggcgttatgctgtaatcaaagaagtgattgctgacccgcatttatcctgtatt
ttacaacatacaaagttaacaggagatagcgattttatttcccaactccagctatacgct
ttatgtgcgccgcatctggaagtcggaggtagaggtaataatggttacgctgtacaagtt
gctggacatcggattctaacggccgagaaagcaggaacatggctagcgctgagtgcaaca
gttccctttactcgtctttcctgtggctacgttggacaaagtgatggttggacagattta
gctgataattttcggatggattgggagtttgacagtgctgtagatggcaaccttgctttg
actggaaaattaaatctcaatggcagtaaagagtttactttagggctggcatttgggaca
actctgcacaatgcaatttccacactgtttcagtcactcaatattccttttgagaagcag
aagcagcaatataacgaacagtggaagcgatcgcgcgacggcatccactcattagaaaat
gcttcttatgatgatgggaagttgtatcacaacagcgttagtttgttgttggcacacgaa
gacaaaagctatcccggtgctttaattgcatctatggctatcccttggggtgaagccaaa
gacgaccaagaccaaggaggatatcaccttgtctggacgcgggatctggtcagtagtgta
acaggtttggtggctgctggggaaacagatacagcagtgcgatcgctaatttatcttgca
accagccagcaagaagatggtggttttgcccaaaatttctgggttgatggtgaaccttac
tggaaaggtattcagctagatgaagtggcatttccaattttactggcatggatattgcac
caagaaaaagtaccactgcactttgatatttatcccatgattttacgagcggcaggttat
ttaattcgtcatggccctgctacccaacaagaacgctgggaagaaaacagtggctattca
ccttctacactggcatctaatattgccgctttaatctgcgctgctcaatttgttcgtgaa
agtggtgatgaagcaacagcacaatttattgaagaatacgccgattttttagaatctcac
attgaagcttggacggttactaccgaaggaaccctggttcctggcatcaaacgccattac
atccgaattactcctacaaatatcaataatcctcaacccaacgaaaatcctaatcaggga
actcttcttattgccagtcagccacctggtgaaccagcagaatttccagcgaaggaaatt
gtcgatggcggattcttacaattagttcgctatggaattcgcaaaccagatgacccgatt
atcgttgattctgtcaaagtaattgatgcaatcttaaaagtagatacacccgttggccct
tgttggcatcgttacaaccacgactgctacggtcaacaagaagatggaagtccttacatt
ggttatggcaagggacacgcttggcctcttttgacaggagaacgaggacattatgaatta
gctgctggcggcgatgtcaaaacatatatcaaggtggtggaaggatttgcttcaaacact
tgtttgttaccagaacaggtttgggatgaagcagatagaccggatatccatcagtatttg
ggaaaaccaacaggttctgcgatgcctttaatgtgggcgcacgcagagtatatcaagctg
ctacggtcaaaccatgatggtcaggtgtttgattttattccagaggtagcgaatcgttat
ttaggcgaaagaaagcagtgtaaatcgttggaaatttggaagtttaaccgtcaaatagac
aaagttaaaaaaggttatacactacgaattcacgctttagcatcttttcaattacactgg
tctgatgataattggcaaactgtaaaagataccccttctacttctacaaagttaggagta
aattttgtagatatttctgtttctgataaccaacagcagccaattatctttacctttttc
tggattgacactagtaaatgggaacaacgcaattacacagttgcagtttcataa

DBGET integrated database retrieval system