KEGG   Nostoc punctiforme: Npun_R5910Help
Entry
Npun_R5910        CDS       T00713                                 

Definition
(GenBank) Glutathione S-transferase, C-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
npu  Nostoc punctiforme
Pathway
npu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Npun_R5910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:npu02000]
    Npun_R5910
Enzymes [BR:npu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Npun_R5910
Transporters [BR:npu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Npun_R5910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_N_4 GST_C Glutaredoxin GST_N
Motif
Other DBs
NCBI-ProteinID: ACC84203
CyanoBase: Npun_R5910
CYORF: Npun_R5910
UniProt: B2JAC8
LinkDB All DBs
Position
complement(7305806..7307011)
Genome map
AA seq 401 aa AA seqDB search
MTTAPLSWEELETLTDYQIDTVNGLTNAKARLRLFGQPESDVRVTLYRDNHAWCPYCQKV
WLWLEEKQIPYRIEKVTMFCYGEKESWYKRKVPSGMLPAIELDGRIIKESDDILIALEKV
FAPLNQGMEDRMVLPLRQLERLLFRAWCVWLCSRAGSSQQEQRNREQFIEMVARIEEALG
RTPSPYFLDSFGIVDVIFTPYLERMNASLYYYKGYSLREENPRLSAWFAAMESRPTYCGT
QSDFHTHAHDLPPQMGGCWENGETQMLLNKARVDNGPWFGLPDVAYPEPENSRMEALKRT
IEHRINIIRVNPLDDKLFDQALRCALTHMMTGEDYVPPSGADVALRYLRDRINVPRDMSI
YAAKRLRESLEKTAALAGDGQPDPIPTKHRRDQDPSNFVIK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcacccttaagctgggaagaactagaaaccctcacggactatcaaatagat
accgttaatggtcttaccaatgctaaagcccggttgcgcttgtttggtcagccagaatct
gatgtgcgggtaacgctgtaccgcgataaccacgcctggtgtccttactgtcaaaaagtt
tggttatggctagaggaaaaacagatcccctaccgcatcgaaaaagtgacaatgttctgc
tatggggagaaagaaagttggtacaaacgtaaggtaccgtcaggaatgctccctgcgatc
gagctagatggacggattattaaggaaagcgatgacattttgatcgctttggaaaaggta
tttgctccattgaaccaagggatggaagaccgcatggtgcttcctctacgtcaattagaa
cgactgttattcagagcctggtgcgtttggctgtgttctagagcaggttcctctcaacaa
gaacaacgcaaccgagaacaatttatcgaaatggtggctaggatcgaggaggctctgggc
cgcacccctagcccttattttctagatagcttcggcatcgtcgatgtcatttttacccca
tatctcgaacggatgaatgcgagcctttactactacaagggctactcactgcgggaggaa
aaccctcgtttgagcgcatggtttgcggcaatggaaagccgaccaacctactgcggtacc
cagagcgactttcacacccacgcacatgatttgccgccccagatggggggctgttgggaa
aacggcgaaacccagatgcttctcaataaagcgcgggtggataatggcccctggtttggg
ctaccagatgttgcttatccagaacccgaaaactcccgcatggaagctcttaagcgaacc
atcgagcatcgcatcaatattatccgagtcaaccccttagatgataaattgtttgaccaa
gcgctacgttgtgctttaacacacatgatgacaggtgaagactatgtacctccatcggga
gctgatgtcgctctccgatatttgcgcgatcgcattaatgtaccgcgagatatgtccatc
tatgcagccaagcgattgagggaatccctggaaaaaaccgcagcccttgcgggtgatgga
cagccagaccccattcccactaaacatcgacgagatcaagacccgtctaactttgtcatc
aagtag

DBGET integrated database retrieval system