KEGG   Novosphingobium resinovorum: BES08_01765Help
Entry
BES08_01765       CDS       T04490                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
nre  Novosphingobium resinovorum
Brite
Enzymes [BR:nre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BES08_01765
Peptidases [BR:nre01002]
 Metallo Peptidases
  Family M2
   BES08_01765
Exosome [BR:nre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BES08_01765
CD molecules [BR:nre04090]
 Proteins
  BES08_01765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AOR75625
UniProt: A0A1D8A0I3
LinkDB All DBs
Position
388028..389851
Genome map
AA seq 607 aa AA seqDB search
MKFASTALAALAASLSFAVVPAHAEDYPQTAEGAAKFVADAEKDLFDFSLGNNQANWVNY
TYITEDTDALAAKSNGDLTEKQVKYAVEAAKFAKVSGLDADVSRKLGILRQGIVLPAPNT
PGAAAQLSEITTRLSSAYGKGKGTLDGKPINGSDIEAEMGNLQHSPAEFAEMWTSWHDNV
GAPMKADYAQMVGIANQGAKELGYADVGAMWRSGYDMTPEQFAAETQRLWEETKPLYLAL
HTYVRRKLNEKYGDAVQPRKGPIRADLLGNMWAQEWGNVYPLVAPQGAGDLGYDIGDLLK
AQGKKPLDMVKAGEGFYSSLGFDPLPGTFWTRSMITKPADREVICHASAWDVDNKDDIRI
KMCTKVNSEDFVTIHHELGHNYYQRAYNKQPYLYLNGANDGFHEAIGDFIALSITPQYLV
QIGLLDKSKVPGADKDIGLLLRQAMDKVAFLPFGLMIDRYRWGIFDGSIQPADYNKAWTK
MRLDYQGITPPSARSDDGFDAGAKFHVPGNTPYTRYFLARILQFQFYQAACKQAGWKGPL
HRCSFYGNKKVGENLNAMLAMGMSKPWPEALKTFTGSPQMSAKPMLDYFAPLKKWLDAQN
KGETSGW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgcctccaccgcgcttgccgcattggctgcaagcctttcgttcgccgtcgtc
ccggcccatgcggaggattacccgcagacggcagagggtgccgcgaagttcgtcgccgat
gccgagaaggacctgtttgacttctcgctgggtaacaatcaggcgaactgggtcaattac
acctacatcaccgaggataccgacgcgctggcggcgaagtccaacggcgacctcaccgag
aagcaggtgaagtacgcagtcgaggcggcgaagttcgcgaaggtttccggtctcgatgcg
gacgtgtcgcgcaagctgggcatcctgcgtcagggcatcgtcctgcccgcgcccaacacg
cccggcgcggcggcgcagttgagcgagatcaccacgcggctatcgtcggcctatggcaag
ggcaagggcacgcttgacggcaagccgatcaacggctcggacatcgaggcggagatgggc
aacctgcagcacagcccggccgaattcgccgaaatgtggaccagctggcacgacaacgtc
ggcgcgccgatgaaggcggactacgcgcagatggtcggcatcgccaaccagggcgcgaag
gaactgggctatgcagacgtcggtgcgatgtggcgttcgggctacgacatgacgcccgag
cagttcgcggcggaaacccagcgcctgtgggaagagaccaagccgctctatctggcgctg
catacttacgtgcgccgcaagctgaacgagaagtacggcgatgcggtgcagccgcgcaag
gggccgatccgcgccgacctgctcggtaacatgtgggcgcaggaatggggcaacgtctac
ccgctcgtcgcgccgcagggtgcgggcgatctcggatatgatatcggtgatctgctgaag
gcgcagggcaagaagccgctcgacatggtgaaggcgggcgagggcttctattcctcgctg
ggcttcgatccgctgccgggcacgttctggacccgctcgatgatcaccaagcccgccgac
cgcgaggtgatctgccatgcctcggcatgggacgtcgacaacaaggacgacatccgcatc
aagatgtgcacgaaggtcaattcggaggatttcgtcacgatccaccacgaactgggccac
aactattaccagcgcgcctacaacaagcagccatatctctacctgaacggcgccaacgac
ggcttccacgaggcgatcggcgacttcatcgcgctgtcgatcacgccgcagtacctcgtg
cagatcggcctgctcgataagagcaaggtccccggcgccgacaaggacatcggcctgctg
ctgcgtcaggcgatggacaaagtcgcgttcctgccgttcggcctgatgatcgaccgctat
cgctggggcatcttcgacggctcgatccagcccgccgactacaacaaggcgtggacgaag
atgcgcctcgactatcagggcatcaccccgccctcggcgcgctcggacgacgggttcgat
gcgggcgcgaagttccacgttccgggcaacacgccttacacccgctacttcctcgcgcgg
attctgcagttccagttctatcaggcggcgtgcaagcaggccgggtggaaggggccgctg
caccgctgcagcttctacggcaacaagaaggtcggcgagaacctgaatgcgatgctggcg
atgggcatgtcgaagccctggcccgaggcgctcaagacgttcaccggctcgccgcagatg
agcgccaagccgatgctggactacttcgcgccgctcaagaagtggctcgacgcgcagaac
aagggcgagacttcaggctggtga

DBGET integrated database retrieval system