KEGG   Novosphingobium resinovorum: BES08_04215Help
Entry
BES08_04215       CDS       T04490                                 

Definition
(GenBank) MBL fold metallo-hydrolase
  KO
K06167  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase [EC:3.1.4.55]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00440  Phosphonate and phosphinate metabolism
nre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BES08_04215
Enzymes [BR:nre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.55  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase
     BES08_04215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B Lactamase_B_3 DUF3237
Motif
Other DBs
NCBI-ProteinID: AOR76047
UniProt: A0A1D8A1P6
LinkDB All DBs
Position
932860..933642
Genome map
AA seq 260 aa AA seqDB search
MKVTVLGSGTSTGVPRLGGENGGADWGLCDPDEPRNRRTRVSILLESDAGARILVDTSTD
LRAQLLANDIHRIDAVFWTHDHADHCHGIDDLRPLRYGRAGPIPGYADSETVRRLRQRFG
YVFAGQHGYPTLISLENLDTLRLCEGFRIGHTQMPHGGMDSTGFLFDAAGKSVGYATDFN
QITRGMIDLFYGCDLLIVDCLRREPHPTHAHLAMSLELAEVCRVGTAVLTHLDKSMDYAT
LSASVPANVQVAYDGLVLTP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcacggtcctcggcagcggcacatcgaccggagtgccccggctcggcggcgag
aacggcggcgccgactggggactgtgcgatccggatgagccgcgcaaccgtcgcacacgg
gtgtcgatcctgctcgaaagcgacgccggtgcccgtatcctcgtcgacacttcgaccgac
ttgcgcgcacaactgcttgccaacgacatccatcgcatcgatgcggtgttctggacgcac
gaccacgccgaccattgccatggtatcgatgacctgcgcccgctgcgctacggccgcgcc
ggaccgatcccgggttatgcggactccgaaaccgtgcggcggttgcggcagcggttcggc
tacgtctttgccggacagcacggctacccaacgctgatttctctggagaatctcgatacc
ctgcggctgtgcgaaggctttcgcataggccatacgcagatgcctcatggcgggatggat
tcgaccggattcctgttcgatgccgctggaaaatcagtcggttatgccacggacttcaac
cagattacgcgtggcatgatcgatctgttctatggctgcgacctgctgatcgtcgattgc
ctgcgccgtgaaccgcaccccacgcatgcccatctggcgatgtcgctggaactggctgaa
gtctgccgggtgggaacggccgtgctgacgcatctcgacaagagcatggactatgccaca
ctgagcgcttcggtgcctgcgaacgtgcaggtcgcttatgatggactggtgcttacgccg
tga

DBGET integrated database retrieval system