KEGG   Novosphingobium resinovorum: BES08_08405Help
Entry
BES08_08405       CDS       T04490                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00630  Glyoxylate and dicarboxylate metabolism
nre01100  Metabolic pathways
nre01110  Biosynthesis of secondary metabolites
nre01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BES08_08405
Enzymes [BR:nre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     BES08_08405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 HTH_18 DUF1967
Motif
Other DBs
NCBI-ProteinID: AOR76766
UniProt: A0A031K538
LinkDB All DBs
Position
1813481..1814131
Genome map
AA seq 216 aa AA seqDB search
MKLAVFDCDGTLVDGQAPICEAMEAAFAAFSLPSPTRGSIRRAVGLSLPQAIRQLLPDSD
AEQQHAMAEAYKLSFRTAREQGRVAQPLFPGIEDTLRALHANGWTLGVATGMSDRGLGFC
LEANGIADLFVTLQTADRHPSKPHPAMLEEALFEAGAQASEAVMIGDTAYDMQMATSAQV
RAVGVDWGYHHPRELSEAGAEMVAETPAQLLEHLLR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggcggtcttcgactgcgacggcaccctcgtcgatgggcaggcgccgatctgc
gaggcgatggaggcggccttcgccgccttctcgctgccttcaccgacgcgcgggagcatc
cggcgtgcggtcgggctttcgctgcctcaggcgatccgccagttgctgcccgattcggac
gccgagcagcaacacgccatggccgaggcctacaagctctcgttccgcaccgcgcgcgaa
cagggccgtgtcgcccagccgctgttcccggggatcgaggacaccttgcgcgcccttcat
gcgaatggctggacgctgggcgtcgccaccggcatgtcggatcgcggcctcggcttctgc
cttgaggcgaacggcatcgccgacctcttcgtgacgctccagaccgccgaccgtcatccc
tccaagccccaccccgcgatgctggaagaggctttgttcgaagcgggcgcgcaggcgtcg
gaagccgtgatgatcggcgacacggcctacgacatgcagatggcgacgtccgcgcaagtc
cgcgcggtcggcgtggattggggctatcaccacccgcgcgaactgtccgaagcgggcgcc
gaaatggtcgccgagaccccggcgcagttgctggagcacttgctcaggtga

DBGET integrated database retrieval system