KEGG   Novosphingobium resinovorum: BES08_09725Help
Entry
BES08_09725       CDS       T04490                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nre  Novosphingobium resinovorum
Pathway
nre00473  D-Alanine metabolism
nre00550  Peptidoglycan biosynthesis
nre01100  Metabolic pathways
nre01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BES08_09725
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BES08_09725
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BES08_09725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nre01011]
    BES08_09725
Enzymes [BR:nre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BES08_09725
Peptidoglycan biosynthesis and degradation proteins [BR:nre01011]
 Precursor biosynthesis
  Amino acid ligase
   BES08_09725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AOR76995
UniProt: A0A031JWS8
LinkDB All DBs
Position
complement(2080521..2081465)
Genome map
AA seq 314 aa AA seqDB search
MSLNPLHVAVLMGGWSSERPVSLMSGEGVAKALESKGHTVTRIDMDRDVALRLAEAKPDV
VFNALHGAPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKELTKQALVPHGVPMPGGRVV
KSADIHVADPLPRPYVLKPVNEGSSVGVAIVTAEGNYGNPIARDVTGPWQEFAELLAEPY
IRGRELTTAVIGDRALLVTELKPKSGFYDFDSKYTDGMTEHVCPADIPDEITQACKDIAL
RSHQLLGCKGTSRSDFRWDDTQGIEGLFLLEVNTQPGMTPLSLVPEQARACGMDYPELVE
AIIAEALSDKAKAK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaatcccctccatgtcgcagtcctgatgggcggttggtcgagcgaacgcccg
gtctcgctgatgagcggcgagggcgtggccaaggctctggaatcgaagggccacaccgtc
acccgcatcgacatggaccgcgacgttgcgctgcgtctggccgaggcgaagcccgatgtc
gtgttcaacgcgctccacggcgcgccgggcgaggacggcacagtgcagggcatgatggac
ctgatgggcctgacttacacgcattcgggcctcgcgacttcggtgatcgcgatcgacaag
gaactgaccaagcaggcgctggtcccgcacggcgtgccgatgccgggtggccgcgtggtc
aagtccgccgacattcacgtggccgatccgctgccgcgtccttatgtgctcaagcccgtg
aacgagggatcgtcggtcggcgtcgccatcgtcacggctgagggcaactacggtaacccc
atcgcgcgcgacgtgacggggccgtggcaggaattcgccgaactgctggccgagccctac
atccgtggacgcgaactgacgactgccgtaatcggcgaccgcgccctgctggtcaccgaa
ctcaagcccaagtcgggcttctacgacttcgattccaagtacaccgacggcatgaccgag
catgtctgcccggccgacatccccgacgagatcacgcaggcctgcaaggacatcgccttg
cgctcgcaccagctgctggggtgcaagggcaccagccgttccgacttccgttgggatgat
acgcaggggatcgaggggctgttccttctcgaagtgaatacccagccgggcatgactccc
ttgagcctcgtgcccgagcaggcgcgcgcctgcggcatggactatcccgaactcgtcgag
gcgatcatcgccgaggcgctaagcgacaaagcaaaggccaaatga

DBGET integrated database retrieval system