KEGG   Novosphingobium resinovorum: BES08_13160Help
Entry
BES08_13160       CDS       T04490                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
nre  Novosphingobium resinovorum
Pathway
nre03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:nre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BES08_13160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nre03400]
    BES08_13160
Enzymes [BR:nre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BES08_13160
DNA repair and recombination proteins [BR:nre03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BES08_13160
 Prokaryotic type
     BES08_13160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AOR78671
UniProt: A0A1D8A976
LinkDB All DBs
Position
complement(2819004..2819693)
Genome map
AA seq 229 aa AA seqDB search
MSATQDVQAVPESWASALGPVLATPEARRLGGWLKAEEAAGKVIYPPRGTRLRALELTPL
DQVRVVILGQDPYHGPGQAHGLSFSVQEGVKVPPSLVNIYKELATDCDVAAPGHGNLEHW
ARQGVLLLNNALTVEAGQAGSHQKRGWEAITDAAVAAVAAKAEPCVFMLWGSHAKKKALS
VPGLMESHHLVLTAPHPSPLSAYQGFFGCGHFSRANAFLAEHGRGTIDW
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaacacaggacgtccaggccgttccggagagctgggcttccgcgctggggccg
gtgcttgccacccccgaggcgcgcaggctgggcggctggctcaaggccgaggaagcggcg
ggcaaggtgatctatcccccgcgcggcacccggctgcgggctctggaactgacgccgctc
gatcaggtgcgcgtggtgattctggggcaggacccctaccacgggccgggacaggcgcat
ggcctgtcgttctcggtgcaggagggggtgaaagtgccgccctcgctggtcaacatctac
aaggaactggcgaccgactgcgatgtcgccgcgccggggcacggcaatctggagcactgg
gcgcggcagggcgtgctgctgctcaacaacgcgctgacggtggaggccgggcaggccggt
tcgcaccagaagcgcggctgggaagcgatcaccgacgcggccgttgcggccgttgcggcg
aaggcggagccctgcgtgttcatgctgtggggcagccatgcgaagaagaaggcgctgagc
gtgccggggctcatggagagccatcatctggtgctgacggcgccgcatccgagcccgctg
tcggcttatcagggattcttcggctgcgggcatttcagccgggccaatgcgtttctcgcg
gagcatgggcgcggcacgatcgactggtga

DBGET integrated database retrieval system