KEGG   Nitratifractor salsuginis: Nitsa_0374Help
Entry
Nitsa_0374        CDS       T01405                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00330  Arginine and proline metabolism
nsa01100  Metabolic pathways
nsa01110  Biosynthesis of secondary metabolites
nsa01130  Biosynthesis of antibiotics
nsa01230  Biosynthesis of amino acids
Module
nsa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Nitsa_0374
Enzymes [BR:nsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Nitsa_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored TrkA_N LPD7 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADV45644
UniProt: E6WZY6
LinkDB All DBs
Position
383483..384229
Genome map
AA seq 248 aa AA seqDB search
MKILLIGAGNMGGAMLEGLREYDVTVVEAYEPRRKELAALYPNITLQNTIPPLDGYVVLL
AIKPQSLDALEVEGRAEALISILAGTPLARLKEKIDAEAYIRAMPNIAALKRKSVTSVTG
DESFKEEALKILSSIGKAIWLNSEKELDIATGIGGSAPAWMALVAEALADGAVNLGLPRA
VSYEYVAALMDGMGALLEEEHPALLKDKVMSPGGTTAAGYAKLEEGGVRDSFIKAMEACY
RRSLELGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctactgatcggtgcgggaaatatgggcggtgcgatgttggaaggcttgcgg
gagtatgacgtaaccgtggtggaagcctatgaacctcggcgcaaagagttggcggcgcta
taccccaatatcacgctgcaaaatacgatccctcctttggacggatacgtggtgcttctg
gcgatcaaacctcagtctctggatgctctggaagtcgaggggagagccgaagcgctgatc
tccatcctggcgggaacccctttggcgaggctcaaagagaagatcgatgccgaggcctat
atccgggcgatgcccaacatcgcggccctcaaacgtaaatcggtcacctcggtcaccggt
gacgaatcctttaaagaagaggcgctgaaaattctctcctccatcggcaaagccatttgg
ctcaacagcgaaaaagagctagatatcgccacgggcatcggcggatcggcgccggcgtgg
atggcgctggtggccgaggctttggccgacggagcggtcaatctgggcctgccccgtgcc
gtgagctatgagtatgtggcggctttgatggacgggatgggggctttgttggaagaggaa
catcccgcgctgctcaaagacaaggtgatgtccccgggaggcactaccgccgccggctat
gccaagctcgaagaggggggtgtacgcgacagcttcatcaaggcgatggaagcgtgctac
cgcagaagcctggaactgggaaaatga

DBGET integrated database retrieval system