KEGG   Nitratifractor salsuginis: Nitsa_2016Help
Entry
Nitsa_2016        CDS       T01405                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nsa  Nitratifractor salsuginis
Pathway
nsa00061  Fatty acid biosynthesis
nsa00071  Fatty acid degradation
nsa01100  Metabolic pathways
nsa01212  Fatty acid metabolism
nsa02024  Quorum sensing
Module
nsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Nitsa_2016
   00071 Fatty acid degradation
    Nitsa_2016
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Nitsa_2016
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nsa01004]
    Nitsa_2016
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsa04147]
    Nitsa_2016
Enzymes [BR:nsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Nitsa_2016
Lipid biosynthesis proteins [BR:nsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Nitsa_2016
Exosome [BR:nsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Nitsa_2016
  Exosomal proteins of breast cancer cells
   Nitsa_2016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ADV47258
UniProt: E6X2X5
LinkDB All DBs
Position
complement(1990387..1991949)
Genome map
AA seq 520 aa AA seqDB search
MGALQYRYNNFYEVVFDHGRRHPRRKALFVGEKTIRYGELLKKVDAFAGTLHHLGIEPED
RVALFMRNSWEFIVAVLAISKVGGITVPINTFLKADELSYILEDSGAKILIASAVHEKVV
HDSIAGEKMERIIWEGGLRLADEKNLSFEEALSQNLQCKPVMRTLDDLAVFFYTSGTTGK
PKGAMLSYKNILSNAESGSRLLHITHRDRTIVFLPMFHAFTFSIGLILPLYVGGGIVIIQ
SLRPFSNIFKQALLKRVTIFFGVPDVYNALAKAKLPWYFMAFNKIRIFVSGAAPLQSKTL
EAMRAKFRRAKMLEGYGLSESSPAVCINPLHKQKDRSVGPAMPGYQVKIVDENMVELPRG
EVGEIILFGDNVMQGYLNRPEATAETIINGWLCTGDMGTMDEEGYLYIVDRKKDLIISKG
INIYPREIEDLIDRFPGVGASAVIGIPDEKNGEVPVAYIEPEEGERPDVTKLKAHLREHL
ANFKIPRKFYITEALPKNATGKVLKRVLKEQLLQQENFEE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcgctgcagtatcggtataacaatttttatgaggtggtcttcgaccacggccgc
cgccacccgcgccgcaaagcgctcttcgtcggggagaagacgatccgctacggggagctg
ctcaaaaaggtggatgcctttgcgggaacgctccatcatctcggcatcgaacccgaggac
cgggtggctctgtttatgcgcaactcctgggagtttatcgtggcggtgctggcgatcagc
aaggtgggcggcattaccgttcccatcaatacctttctcaaagccgacgaactcagctac
atcctcgaagacagcggggcgaagatcctgatcgcttccgcggtccacgaaaaggtggtc
cacgactccatcgccggagagaagatggagcggatcatctgggaagggggattgcgcctg
gcagacgagaagaacctcagcttcgaagaggcgctttcccagaacctacagtgcaaaccg
gtgatgcggacgctggatgatctggccgttttcttctacacttccgggaccaccggcaaa
cccaagggggcaatgctcagttacaaaaacatcctctccaacgccgagtcgggaagccgc
ctcctgcacatcacccatcgggaccgcaccattgtcttcctgccgatgtttcacgccttt
accttctccatcggcctgatcctgcctctctatgtaggaggggggatcgtcatcatccaa
tccctgcgtcccttcagcaacattttcaagcaggcgcttctgaagcgggtgacgatcttc
ttcggggtccccgatgtttacaacgccctggccaaggcgaagctgccgtggtatttcatg
gccttcaacaagatccggattttcgtctcgggagcggcaccgctgcaatccaagaccctc
gaagcgatgcgcgcaaagttccgccgggcgaagatgctcgagggttacggcctgagcgaa
agctcccccgccgtctgcatcaacccccttcacaaacaaaaagaccgttccgtgggcccc
gctatgccgggataccaggtcaagatcgtcgacgaaaatatggtggagttgccccgtggg
gaagtgggggagatcatcctcttcggcgataatgtgatgcagggctatctcaaccgcccg
gaagcgacggccgagaccatcatcaacggctggctctgtaccggggatatggggactatg
gatgaggaagggtatctttacatcgtcgatcgcaagaaagacctgattatctccaagggg
atcaatatctatcccagggagatcgaagacctgatcgaccgtttcccgggggtgggtgct
tcggcggtcatcggaatccccgacgaaaagaacggggaagtccccgtggcctatatcgag
cccgaggagggagagcgcccggatgttaccaagctcaaagcccatctgcgggagcatctg
gctaacttcaaaattccccggaaattctacatcaccgaagctcttcccaaaaacgccacc
ggcaaagtgctcaaacgggtcttgaaagagcaactgcttcagcaggagaacttcgaggag
tag

DBGET integrated database retrieval system