KEGG   Nonlabens sediminis: BST91_01700Help
Entry
BST91_01700       CDS       T04875                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nsd  Nonlabens sediminis
Pathway
nsd00473  D-Alanine metabolism
nsd00550  Peptidoglycan biosynthesis
nsd01100  Metabolic pathways
nsd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nsd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BST91_01700
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BST91_01700
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BST91_01700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nsd01011]
    BST91_01700
Enzymes [BR:nsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BST91_01700
Peptidoglycan biosynthesis and degradation proteins [BR:nsd01011]
 Precursor biosynthesis
  Amino acid ligase
   BST91_01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 GARS_A DUF1344
Motif
Other DBs
NCBI-ProteinID: ARN70458
LinkDB All DBs
Position
complement(331303..332274)
Genome map
AA seq 323 aa AA seqDB search
MKNIAVLMGGYSSEKDISMKSGKVISKYLNKDLYQVYEIVISEQSWSYTSTDGEVHEIDK
NDFSITINDNKVIFDCCYNTIHGTPGEDGLLQAYLELIGLPQTSCDSYQSAITFNKRDCI
AVLKPWGITTAQSVYLNQSQEVDVNLIVDRVGLPCFVKANRSGSSYGVSKVYQIEQLPAA
LDVAFAVDNEIIIESFLDGIEVSVGVYKKDGTIIALPPTEIVSENDFFDYEAKYQGKSQE
ITPARISERMTVAVQELSKRIYELLNCKGIARADFIFHQGTPHFIEINTNPGMSEESIVP
KQVEASNQSLTDFLTDIIEETLN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattgccgtactcatgggtggctattccagtgagaaagacatctcgatgaag
agtggaaaggtaatttccaaatatttaaacaaagatctttaccaggtctatgaaattgta
atatcagagcagtcatggagctacaccagtacagatggtgaggtccatgagattgataaa
aatgatttttcaatcacaattaatgacaataaagtaatatttgattgttgctacaatacc
attcacggtactcctggtgaggatggactgttacaagcatacttagaattaataggcttg
ccgcaaacctcttgtgatagttaccaaagtgcaattaccttcaataaaagggactgcatt
gcagtgttgaaaccatggggaataactactgcacaaagtgtatatttaaatcagtctcaa
gaggtcgatgtgaatctaatagttgatcgagtgggattgccttgttttgttaaagcaaat
cgcagtggaagtagttatggtgtttcaaaagtttatcaaatcgaacagttaccagctgca
cttgatgtagcatttgcggtagataacgagattattattgagtcctttctagatggcatc
gaagtttctgtaggtgtgtataaaaaagatggtactatcatcgctttaccacctactgaa
attgtaagtgaaaatgatttttttgattatgaagccaaatatcaaggaaaatcccaagaa
attacgcctgcaagaattagtgaacgtatgacagttgctgttcaagaattaagtaaaaga
atctacgaattacttaattgtaagggtatagcacgtgccgactttatattccatcaagga
acacctcatttcattgaaataaataccaatccaggtatgagtgaggaaagtatagttcct
aaacaagtagaagcctctaatcaatccttaactgattttttaaccgatatcattgaggaa
accttaaattag

DBGET integrated database retrieval system