KEGG   Nonlabens sediminis: BST91_09575Help
Entry
BST91_09575       CDS       T04875                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nsd  Nonlabens sediminis
Pathway
nsd00010  Glycolysis / Gluconeogenesis
nsd00020  Citrate cycle (TCA cycle)
nsd00620  Pyruvate metabolism
nsd01100  Metabolic pathways
nsd01110  Biosynthesis of secondary metabolites
nsd01120  Microbial metabolism in diverse environments
nsd01130  Biosynthesis of antibiotics
nsd01200  Carbon metabolism
Module
nsd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BST91_09575
   00020 Citrate cycle (TCA cycle)
    BST91_09575
   00620 Pyruvate metabolism
    BST91_09575
Enzymes [BR:nsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BST91_09575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 RnfC_N HlyD_3 PYNP_C QRPTase_N ATP-gua_Ptrans
Motif
Other DBs
NCBI-ProteinID: ARN71879
LinkDB All DBs
Position
complement(2071176..2072828)
Genome map
AA seq 550 aa AA seqDB search
MAEIVNMPRLSDTMEEGVVAAWLKQVGDQVEEGDILAEIETDKATMEFESFQSGTLLHIG
VQEGETAPVDSLLCIIGEEGEDIQALLDGAGDSSNTENEDSSNTQDSNEDKNDEPSSSTD
DSNDLPDGVEIITMPRLSDTMEEGTVASWLKKEGDQVEEGDILAEIETDKATMEFESFHS
GTLLKIGIQEGETAAVDALLAIIGPEGTDVSNVSLDGTSNSSTKKEEKKEAPAKEEPKSQ
PKKQEPKKEETKTVSNSSNSTSSSNTGRVFASPLAKKMAQDKGIDLSQVQGSGENGRIIK
KDIESFTPGTSTGVSQPAFEAVGEETFVEMANSQMRKTIAKRLSQSKFTAPHYYLGIELD
MDNAIASRKAINELPDTKVSFNDMVIKAAAMALRKHPQVNTQWTDKNTIQAKHIHVGVAV
AVDDGLLVPVLPFADQMSMQQIGAKVKELAVKARNKKLQPKEMEGSTFTISNLGMFGITE
FTSIINQPNSAIMSVGTIVQKPVVKNGQIVVGNTMKITLACDHRTVDGATGAAFLQTFKQ
YMENPIVMYV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattgtaaacatgcctagattaagcgacaccatggaagaaggtgtcgtggca
gcgtggcttaagcaagtaggtgatcaagttgaagaaggtgatattcttgcagaaattgaa
acagacaaggctaccatggaatttgaatcatttcaaagtggtactttattacacataggt
gttcaagaaggtgaaaccgcacctgttgattcgcttttatgtataatcggtgaagaaggt
gaggatattcaagctttactagatggcgctggggattcatccaatacagaaaacgaagat
tcttctaatactcaagattcaaatgaagataagaacgatgaaccttcatcttcaactgat
gattctaatgatttacctgatggagtggaaatcattactatgccgcgattgagtgatacc
atggaagaaggtacagttgcaagctggttgaaaaaagaaggtgatcaagttgaagaaggt
gatatccttgcagaaattgaaacagataaggctaccatggagtttgagtcatttcatagt
ggaactcttcttaaaattggtatacaagaaggagaaactgctgctgtagacgctttgtta
gctatcattggtcctgaagggacagatgtttccaatgtatccttagatggaacttctaat
tcttcaacaaagaaggaagagaaaaaagaagcgccggccaaagaagaaccaaaatctcaa
ccaaaaaagcaagagcctaagaaggaagaaacaaagactgtttctaattcaagtaactca
acttctagtagtaatacaggccgtgtttttgcatcaccactagcaaagaagatggctcag
gataaaggaatcgacttgtcgcaggttcaaggttctggagaaaatggtcgtatcattaaa
aaggatatagaaagttttactcctggaacttctacaggtgtctctcaacctgcttttgaa
gctgttggagaagagacatttgttgaaatggcaaattctcaaatgcgcaagaccattgca
aaacgtttgagccaatccaaatttacagcaccacactattatctaggaattgaactagat
atggataatgctattgcaagtagaaaggcaatcaatgagttgccagatactaaggtgagt
tttaatgatatggttattaaagcagctgcaatggcattgagaaaacatccacaggtgaat
actcaatggacagataaaaacaccatacaggcgaagcatattcacgtaggagttgctgtt
gccgttgatgatggtttactggttccagtgttaccgtttgcagatcaaatgagtatgcaa
caaataggtgcaaaagtaaaagagctagctgttaaagcccgtaataaaaagttacaacct
aaggaaatggaaggtagtacttttactatttcaaatcttggaatgtttggtattactgaa
tttacttctataatcaatcagcctaacagtgcaatcatgtcagtaggtactatcgttcaa
aaaccagtggttaagaacggtcagattgtagttggtaatactatgaaaatcactttagct
tgtgatcaccgtacagttgatggtgcaacgggagctgcattcttacaaacatttaaacaa
tacatggaaaaccctatcgttatgtacgtatag

DBGET integrated database retrieval system