KEGG   Nonlabens sediminis: BST91_11620Help
Entry
BST91_11620       CDS       T04875                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
nsd  Nonlabens sediminis
Pathway
nsd00240  Pyrimidine metabolism
nsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BST91_11620
Enzymes [BR:nsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BST91_11620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK SpoIID
Motif
Other DBs
NCBI-ProteinID: ARN72620
LinkDB All DBs
Position
2543886..2544530
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAVDVRYDEEM
VVSHDANEIQSTPVPAAANIPLLAMNCDVVGIDEAQFFDNEIVKVCNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAQYSYRKTADDDVVLLGEHQEYEP
LSRAAYYKAMLEDKVKRIPVKDPESISSKSTNDS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagaaaatacggtaaatcataaagaacagtttggctggattgaagtcatttgt
ggctcaatgttttctggaaaaacagaagagcttattagaagacttaaaagggctcaattt
gctaaacagaaagtagaaatctttaaaccggcagttgatgtacgctatgatgaagaaatg
gtcgtttcacatgatgccaatgaaattcaaagcacaccggttcctgctgccgcaaatatt
cctttactagctatgaattgcgatgtggtagggatcgatgaagcgcaattctttgataac
gagattgtaaaagtatgcaatgatctagctaatagtggtataagagttatcgttgcagga
ttagacatggatttcaaaggcaatccatttggtcctatgccagctcttatggcaaccgcc
gaatacgtgactaaagtacacgcagtttgtactcgcacgggtaatcttgctcaatacagt
tatcgtaaaactgccgatgatgacgtagtccttttaggggaacatcaagaatatgagcct
ttaagtcgcgcggcttattacaaagcaatgctcgaggataaagtaaaacgcataccggtc
aaagatccagaatcaatctcctcaaaatcaaccaatgattcatag

DBGET integrated database retrieval system