KEGG   Nostoc sphaeroides: GXM_03772
Entry
GXM_03772         CDS       T06325                                 

Definition
(GenBank) DLAT, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nsh  Nostoc sphaeroides
Pathway
nsh00010  Glycolysis / Gluconeogenesis
nsh00020  Citrate cycle (TCA cycle)
nsh00620  Pyruvate metabolism
nsh01100  Metabolic pathways
nsh01110  Biosynthesis of secondary metabolites
nsh01120  Microbial metabolism in diverse environments
nsh01200  Carbon metabolism
Module
nsh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GXM_03772
   00020 Citrate cycle (TCA cycle)
    GXM_03772
   00620 Pyruvate metabolism
    GXM_03772
Enzymes [BR:nsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GXM_03772
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL
Other DBs
NCBI-ProteinID: QFS46291
UniProt: A0A5P8W121
LinkDB
Position
Gxm1:complement(3416237..3417517)
AA seq 426 aa
MPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHIIVEAGET
APVGSAIAFIAETEAEIEQAKSLANSGGAAATTTSSPEPVPAKASAATPALASQNGSNHK
EGRLVASPRARKLAKELKVDLTTLQGSGPHGRIVAEDVEALSNQGKQPAPAPVAPPAPVP
TSAPVAPPAPRTPAPAPAVAAVPGQIVPLTTFQNAVVRNMVATISVPVFRVGYTITTDGL
DKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVAVAMDDGGL
ITPVLQNADAVDIYSLSRTWKSLVERARAKQLQPQEYNSGTFTLSNLGMFGVDKFDAILP
PGQGSILAIGASRPQVVATSDGLFGVRQQMQVNITSDHRIIYGAHAAAFLQDLAKLIETN
PQSLTM
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgccggcgctgagttccaccatgacggaaggcaaaatcgtttcctgggtgaaatcgcca
ggggacaaagtggaaaaaggcgaaacagtggtggttgtagagtcagataaggcagatatg
gatgtagaaaccttttatgaaggctttcttgctcatatcatagttgaagctggtgaaact
gcccccgtaggatctgcgatcgccttcatcgccgaaacggaagctgaaattgaacaggcg
aaatctcttgccaattctggcggcgcggctgctactactacctcttcccctgaaccagtc
cccgccaaagcttcagccgcaacacctgccttagcgtctcaaaacgggtctaaccacaaa
gaaggaaggcttgtagcctcaccccgggcccgcaaattagccaaagaactcaaagttgat
ttaactacactccaaggcagtggcccccacggtcgcattgtcgccgaagatgtagaagca
ttgtctaatcagggcaagcaacctgcacctgccccagttgccccaccagcgcctgtacca
accagcgccccagttgcacccccagcacctcgcacacccgcacccgcgccagcagtagcg
gctgttcctggtcaaatcgtgcctctaactaccttccaaaatgcggtagtgcggaacatg
gtagctaccatatccgtgcccgtcttccgtgtcggttatacaattactactgatgggtta
gacaaactttataaacaaattaaatccaaaggtgtgacaatgacagcgctactggcgaaa
gctgtagcggtaacgttgcaaaaacacccattgttaaatgctagttactcagaccagggt
attgtttatcattctgatatcaacatttctgtagctgtggcgatggatgatggcggatta
attacacctgtgctgcaaaatgcagacgcagttgatatatattctctatcgcgtacttgg
aagtctttggtagaacgtgccagggcaaaacaactacagccccaagaatacaacagtggt
acttttaccctgtccaatttggggatgtttggcgtggataaatttgatgcgattttgccg
cctggacaaggttcaattttagcgatcggggcatcccgcccgcaagtagtagcaacatct
gacggtttatttggcgtgcgtcaacaaatgcaagtaaatattacttctgaccaccggatt
atttatggtgcccatgctgcggcgttcttgcaagatttagcgaaattgattgagacaaat
cctcaatctttgacaatgtaa

DBGET integrated database retrieval system