KEGG   Nostoc sphaeroides: GXM_03772Help
Entry
GXM_03772         CDS       T06325                                 

Definition
(GenBank) DLAT, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nsh  Nostoc sphaeroides
Pathway
nsh00010  Glycolysis / Gluconeogenesis
nsh00020  Citrate cycle (TCA cycle)
nsh00620  Pyruvate metabolism
nsh01100  Metabolic pathways
nsh01110  Biosynthesis of secondary metabolites
nsh01120  Microbial metabolism in diverse environments
nsh01130  Biosynthesis of antibiotics
nsh01200  Carbon metabolism
Module
nsh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GXM_03772
   00020 Citrate cycle (TCA cycle)
    GXM_03772
   00620 Pyruvate metabolism
    GXM_03772
Enzymes [BR:nsh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GXM_03772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL
Motif
Other DBs
NCBI-ProteinID: QFS46291
LinkDB All DBs
Position
Gxm1:complement(3416237..3417517)
Genome map
AA seq 426 aa AA seqDB search
MPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHIIVEAGET
APVGSAIAFIAETEAEIEQAKSLANSGGAAATTTSSPEPVPAKASAATPALASQNGSNHK
EGRLVASPRARKLAKELKVDLTTLQGSGPHGRIVAEDVEALSNQGKQPAPAPVAPPAPVP
TSAPVAPPAPRTPAPAPAVAAVPGQIVPLTTFQNAVVRNMVATISVPVFRVGYTITTDGL
DKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVAVAMDDGGL
ITPVLQNADAVDIYSLSRTWKSLVERARAKQLQPQEYNSGTFTLSNLGMFGVDKFDAILP
PGQGSILAIGASRPQVVATSDGLFGVRQQMQVNITSDHRIIYGAHAAAFLQDLAKLIETN
PQSLTM
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgctgagttccaccatgacggaaggcaaaatcgtttcctgggtgaaatcgcca
ggggacaaagtggaaaaaggcgaaacagtggtggttgtagagtcagataaggcagatatg
gatgtagaaaccttttatgaaggctttcttgctcatatcatagttgaagctggtgaaact
gcccccgtaggatctgcgatcgccttcatcgccgaaacggaagctgaaattgaacaggcg
aaatctcttgccaattctggcggcgcggctgctactactacctcttcccctgaaccagtc
cccgccaaagcttcagccgcaacacctgccttagcgtctcaaaacgggtctaaccacaaa
gaaggaaggcttgtagcctcaccccgggcccgcaaattagccaaagaactcaaagttgat
ttaactacactccaaggcagtggcccccacggtcgcattgtcgccgaagatgtagaagca
ttgtctaatcagggcaagcaacctgcacctgccccagttgccccaccagcgcctgtacca
accagcgccccagttgcacccccagcacctcgcacacccgcacccgcgccagcagtagcg
gctgttcctggtcaaatcgtgcctctaactaccttccaaaatgcggtagtgcggaacatg
gtagctaccatatccgtgcccgtcttccgtgtcggttatacaattactactgatgggtta
gacaaactttataaacaaattaaatccaaaggtgtgacaatgacagcgctactggcgaaa
gctgtagcggtaacgttgcaaaaacacccattgttaaatgctagttactcagaccagggt
attgtttatcattctgatatcaacatttctgtagctgtggcgatggatgatggcggatta
attacacctgtgctgcaaaatgcagacgcagttgatatatattctctatcgcgtacttgg
aagtctttggtagaacgtgccagggcaaaacaactacagccccaagaatacaacagtggt
acttttaccctgtccaatttggggatgtttggcgtggataaatttgatgcgattttgccg
cctggacaaggttcaattttagcgatcggggcatcccgcccgcaagtagtagcaacatct
gacggtttatttggcgtgcgtcaacaaatgcaagtaaatattacttctgaccaccggatt
atttatggtgcccatgctgcggcgttcttgcaagatttagcgaaattgattgagacaaat
cctcaatctttgacaatgtaa

DBGET integrated database retrieval system