KEGG   Nostoc sphaeroides: GXM_04906Help
Entry
GXM_04906         CDS       T06325                                 

Definition
(GenBank) ABC transporter permease
Organism
nsh  Nostoc sphaeroides
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF530
Motif
Other DBs
NCBI-ProteinID: QFS47414
LinkDB All DBs
Position
Gxm1:4437000..4438751
Genome map
AA seq 583 aa AA seqDB search
MMPNLTDKIGDWNPQLLREIKGRLKFFNVAIAVATSLLLQLVVFLYQLRDLPDDRYSLTG
AYCPLRQVYELQQKQVYQESNQSTINEFSDFLLNNFCPQNQINWQLWWRDHWEYIFLTFS
VIFVFTLLVAGTYLLINDLAKEESRGTLNFIRLSPQSETSILTGKLLGVPSLVYLVILVA
VPLHLLAGRSAKIAFSYIFSYYAILIASCIFFYSAALLFGLVTRWFSGFQPWLGSGAVLF
FLFTTILIASSYSNSLNNSTAWLRLFAPWDAINYLFPNLLRVHHSSHLKNLEFFYLPLGK
NIVSVVGFYLLNFGLCSYGILQALKRCFRNPQASIISKKQSYLLVAFCQVMMWGFSLQSW
RNNSRFNEFVAQNLVFLALYNLVLLLSLIAVLSPHRQDVQDWARYRHQEVSSRKSVWQDL
IWAEKSPAIVAIAINLTIVAIPWLPWIALTSVFDTEYSENFDRLKVLLAVALSISIIMIY
ATIAQLIVLQKTPKRSFWAIGTIGTVTLLPPIILEFLGISLWEHPTIWLFSSFPWAAIQY
SGATTIFMAFLAQLSVLALLNFQLTKQVRLAGESATKALLAGR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccaatttaacagacaaaatcggcgactggaatccgcaattattgcgggaaatc
aaaggacggctgaaattttttaatgttgcgatcgcagttgcaacatcactacttctacaa
ctcgtagtttttctatatcaattacgcgacttacctgatgatcgatactccctaactgga
gcatactgtcctttacgtcaagtatatgaactgcaacaaaagcaggtttaccaagaatca
aatcaatctacaattaatgagttcagtgattttctgttaaataacttttgcccccaaaac
caaattaattggcaattgtggtggcgagatcactgggaatatatatttctaacatttagt
gtaatttttgtatttacactattagttgcaggaacttatttgctaatcaacgatttagca
aaagaagaaagtcgcggcacattgaattttatccgtctcagcccacaatcagaaacaagt
atattgactggtaaattgctaggagttccgagtttagtttatctcgtaatcttagttgca
gttcctttgcatctgttggctggacgttctgccaaaattgcctttagttacatttttagt
tactacgccattcttattgctagctgtattttcttctacagtgctgcacttctctttggt
ttagttactcgttggtttagcggtttccagccttggttaggtagtggtgcagttttattt
ttcttgttcacaacaatattgatagcgtcgtcttatagcaacagtttaaataattcaact
gcttggttaaggcttttcgctccttgggatgcaataaattatctgtttcctaacttgtta
cgtgtacatcatagttctcacctgaaaaacttagagtttttctatttgccgttaggaaaa
aatattgttagtgttgttggcttctatttattgaactttggattgtgcagttacggaatt
ttacaagctctcaaacgttgcttccgtaatcctcaagcctcaatcatcagcaaaaaacaa
agttatttattggtagctttttgtcaggtgatgatgtggggatttagcttacaatcttgg
cgaaacaactctagatttaatgaatttgttgcacaaaatttagtttttctggcactatac
aacttggtgttacttctcagtttaattgccgttctttctcctcatcgtcaagatgtacaa
gattgggcaagataccgacatcaagaagtttctagtcgtaagagtgtttggcaggatcta
atttgggcggaaaaaagccctgcaattgtagcgatcgctattaatctgacaattgttgct
atcccttggctaccctggattgcacttacatctgtttttgatacagaatatagcgaaaat
tttgacaggttaaaagtacttttagctgtagctttgtctattagcatcatcatgatttac
gctaccattgcccaattgatagttttgcagaaaactcccaaacgttccttctgggcaata
ggtactataggtacggtaacgttgctaccaccgataattctagaatttctcggcatctcc
ttgtgggaacatcctactatatggctgttttcaagttttccttgggcagcgatacaatac
tctggggcgacaacaatttttatggcattcctagctcagttaagtgttttagcgttgttg
aacttccagttaacaaagcaggtgagattagcaggtgaatctgctacgaaagcattatta
gcgggacgctaa

DBGET integrated database retrieval system