KEGG   Neisseria mucosa FDAARGOS_260: A6J88_00015Help
Entry
A6J88_00015       CDS       T04958                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nsi  Neisseria mucosa FDAARGOS_260
Pathway
nsi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A6J88_00015
Enzymes [BR:nsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A6J88_00015
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A6J88_00015
    1.1.1.-  
     A6J88_00015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N NAD_binding_2 Semialdhyde_dh 2-Hacid_dh_C AdoHcyase_NAD NAD_binding_3 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: ARC49862
UniProt: A0A1V0HAX4
LinkDB All DBs
Position
1333..2397
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDLKVGQHVVVEPYIIRDDVPTGEGSNYHLSKDMNF
IGLGGCGGGLAEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKAGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYILDPSEVDVVEEVKKLTNG
EGVDVAFECTSVNKVLDTMVEACRPTAKVVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDELISEGFERLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgataaaggcgacatccgcatcgaagacatccccgaaccg
accgtcgcccccggcaccgtcggcatcaacgtcgcctggtgcggcatctgcggtaccgac
ctgcacgaatttatggaaggtccgattttcatcccgccctgcggccatccgcatccgatt
tccggtgagtccgcgcccgtaacgatgggacacgagttctccggcgtggtttatgccgtc
ggcgaaggcgtggacgacctcaaagtcggacaacacgtcgtggtcgaaccctacatcatc
cgcgatgacgtaccgacaggcgaaggcagcaactaccacctctccaaagacatgaacttc
atcggcttgggcggctgcggcggcggccttgccgaaaaaatcgccgtcaaacgccgctgg
gtgcatccgatttccgacaaaatcccgttagaccaagccgctttgattgaacccctgtcc
gtcggccatcacgcctacgtccgcagcggcgcgaaagcaggcgacgtggcattggtcggc
ggcgcaggcccgatcggtttgctgcttgccgccgtattgaaagccaaaggcatcaaagtc
atcatcaccgaattgagcaaagcgcgcaaagacaaagcccgcgaatccggcgttgccgac
tatatcctcgacccgtctgaagtcgatgtcgtcgaagaagtgaaaaaactgaccaacggc
gaaggcgtggacgtcgcattcgaatgcaccagcgtcaacaaagtactggacaccatggtc
gaagcctgccgcccgaccgcgaaagtcgttatcgtatccatatggagccaccccgccacc
atcaacgtccacagcgtcgtgatgaaagagctggacgtgcgcggcaccatcgcctactgc
aacgaccacgccgaaaccatcaaactggtggaagaaggcaaaatcaaccttgaacctttc
atcacccagcgcatcaagctggacgagctgatttccgaaggcttcgagcgtctgattcac
aacaacgaatctgccgttaaaatcatcgtcaatcccaacctgtaa

DBGET integrated database retrieval system