KEGG   Neisseria mucosa FDAARGOS_260: A6J88_01435Help
Entry
A6J88_01435       CDS       T04958                                 

Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
nsi  Neisseria mucosa FDAARGOS_260
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nsi03021]
    A6J88_01435
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nsi02000]
    A6J88_01435
Transcription machinery [BR:nsi03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     A6J88_01435
Transporters [BR:nsi02000]
 Other transporters
  Pores ion channels [TC:1]
   A6J88_01435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-ProteinID: ARC50108
LinkDB All DBs
Position
complement(300364..300969)
Genome map
AA seq 201 aa AA seqDB search
MMTLYSGITCPFSQRCRFVLYEKGMDFEIKDVDIFNKPEDLAVMNPYNQVPVLVERDLIL
HESNIINEYIDERFPHPQLMPGDPVMRGRGRLVLFRMEKELFNYVHVLENPNATNKEQAK
AREAIGNGLTMLAPAFAKSKYILGEDFSMIDVALSPLLWRLDHYDIKLGKSAAPLLKYAE
RIFQREAFIEALTPAEKAMRR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccttatattcaggcattacctgcccgttcagccaacgctgccgtttcgtgttg
tacgaaaaaggcatggattttgaaatcaaagatgttgatattttcaacaaacccgaagac
cttgccgtcatgaatccgtacaatcaagtacctgttttggttgaacgcgacctcatcttg
cacgagtccaacatcatcaacgaatatatcgacgaacgtttcccgcatccgcaactgatg
cccggcgatcccgtgatgcgcggacgcgggcgtttggtgttgttccgcatggaaaaagaa
ttgttcaactacgttcatgttttggaaaaccccaacgcgaccaacaaagaacaggctaaa
gcgcgcgaagccatcggtaacgggctgacaatgctggctcctgcttttgcgaagagcaaa
tacatcctcggcgaagatttttctatgattgacgtagcgctgtctcctttgttgtggcgg
cttgatcattacgacatcaaactcggcaaatccgccgcacctttgttgaaatacgccgag
cgcattttccaacgcgaggctttcatcgaagcactgacgcccgccgaaaaagccatgcgc
cgataa

DBGET integrated database retrieval system