KEGG   Neisseria sicca: A6J88_09250Help
Entry
A6J88_09250       CDS       T04958                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
nsi  Neisseria sicca
Pathway
nsi00550  Peptidoglycan biosynthesis
nsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6J88_09250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nsi01002]
    A6J88_09250
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nsi01011]
    A6J88_09250
Enzymes [BR:nsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A6J88_09250
Peptidases [BR:nsi01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   A6J88_09250
Peptidoglycan biosynthesis and degradation proteins [BR:nsi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   A6J88_09250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Transpeptidase 7TMR-HDED Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ARC51377
UniProt: A0A1V0HEX2
LinkDB All DBs
Position
1869388..1870641
Genome map
AA seq 417 aa AA seqDB search
MKKTLSVLIAAMMITAAQAAPQAAKNNAASAVAASEPAPAAASQPEAMMPSINSPDAPPA
IAAAAYIVTDLHSHQVLASNNIDTQIEPASLTKMMTAYLAFKALENGTLRADQMLTVSDA
GWKIEGSRMFLNPKVPASVSDLIKGMIVQSGNDAATTLAEAMGGGSVDVFVQQMNEEAKR
LGMTKTHFKNPTGLAAEGHVSTVGDLAVLSAALIHDYPKYYPVFSIKSFKYNNVEQPNRN
LLLYRDSNVDGLKAGHSESAGYNLAASSKRNGRRIVSIVVGTDSTEARASESGKLLNWAL
QAFDTPKLYNGGEIISKVKVYKGSSKSVNVGFLEDVYITIPHNAGQNIKPILETVQPVVA
PIRKGQNLGKLKIVKDGKVITEKNVVALHSVEEGSWFRRMWDDIVLWFKGLFGSSSK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattatccgtattgatcgcggcgatgatgattaccgccgcgcaagccgcg
ccgcaagcggctaaaaacaacgcagcctccgcagttgccgcttccgagccggctcctgcc
gccgcgtcccagcccgaagccatgatgccaagcatcaacagtcccgatgcgccgcctgcc
attgccgctgccgcatacatcgttaccgatttgcacagccatcaagtgcttgcctctaac
aatatcgacacgcagatcgaaccggcttcgttgaccaaaatgatgaccgcctacctcgcg
ttcaaggctttggaaaacggcacattgcgcgccgaccaaatgctgaccgtgtccgatgca
ggctggaaaatcgaaggctcgcggatgttcctcaatcccaaagttcccgccagcgtcagt
gatttgattaaaggcatgattgtccaatccggcaacgatgccgctaccacgcttgccgaa
gccatgggaggaggctcggtggacgtgttcgtccaacaaatgaacgaagaagccaagcgt
ttgggcatgaccaaaacccactttaaaaacccgaccggattggctgccgaaggtcatgtt
tccaccgtcggcgatttagccgttttgtccgccgcgctgatacacgattatccgaaatac
tatcccgtattttcgattaaatccttcaaatacaacaatgtcgaacagccaaaccgcaac
ctcctgctctaccgcgattccaatgtggacggcctgaaggcaggacattccgaaagcgca
ggctacaacctcgccgcttccagcaaacgcaacggcagacgcatcgtttccatcgttgtc
ggtaccgattccaccgaagcccgcgcttccgaaagtggcaaactgctcaactgggcattg
caggcattcgacacgcccaagctctacaacggcggcgaaatcatttctaaggtcaaagtt
tacaaaggcagtagcaaatcggtgaacgtcggcttcctcgaagacgtgtacatcacgatt
ccccacaatgccggacaaaacatcaaaccgattttagaaaccgtccagcccgttgtcgcc
ccgatacgcaaaggtcaaaacttgggcaaacttaaaatcgtcaaagacggcaaagtcatt
accgagaaaaacgttgtcgcactccattccgttgaagaaggcagctggttcagacggatg
tgggacgatatcgtattgtggttcaaaggcttgttcggcagcagttcgaaatag

DBGET integrated database retrieval system