KEGG   Neisseria sicca: A6J88_12580Help
Entry
A6J88_12580       CDS       T04958                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nsi  Neisseria sicca
Pathway
nsi00020  Citrate cycle (TCA cycle)
nsi00310  Lysine degradation
nsi00380  Tryptophan metabolism
nsi01100  Metabolic pathways
nsi01110  Biosynthesis of secondary metabolites
nsi01120  Microbial metabolism in diverse environments
nsi01130  Biosynthesis of antibiotics
nsi01200  Carbon metabolism
Module
nsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6J88_12580 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    A6J88_12580 (sucA)
   00380 Tryptophan metabolism
    A6J88_12580 (sucA)
Enzymes [BR:nsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A6J88_12580 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ARC51926
UniProt: A0A1V0HGD5
LinkDB All DBs
Position
complement(2544891..2547719)
Genome map
AA seq 942 aa AA seqDB search
MMDEKLNFSYLFGSNAPYIEELYENFLENPNSVDEKWKQYFTDLSKQPGAADVDIAHAPI
RESFANLAKTKSTAAIAGGMDEAMMKKQVGVLRLISAYRIQGVGAAQLDPLKRIPPRNIE
ALDPKFHGLNDADMAVQFNMGEGDFSGQSKLPLSQIISNLKQTYCGHLALEYIYIPNTEE
RRWLRNYFEDVLSTPSYSAEQKRRILKEMTAAETLERYLHTKYVGQKRFGVEGGESVIAG
LNYLIQNAGKDGVEEVIIGMAHRGRLNVLVNILGKKPGDLFAEFEGRAEIKLPSGDVKYH
MGFSSDIATPNGPMHVSLAFNPSHLEIVNPVVEGSARAKQKRLGENGRDKVLPVLIHGDS
AFVGLGVNQATFNLSKTRGYTTGGTVHIVINNQIGFTTSDTRDTRSTVHCTDVAKMVSAP
VIHVNGDDPERVCFAIQAALDYRKKFNKDIVIDVVCYRKWGHNEGDDPTLTQPMMYKKVS
QHPGARALYTEQLIAEGVVTQAEADGYIQAYRDALDKGEHVEQTTLSNFQRTQIDWSKYQ
GKDWREDVETGLPAADIERLAEKFTAVPEGFALHPTAKRVLEARKGMAAGSQPIDWGMAE
TLAYASLVTKGHGVRISGEDSGRGTFSHRHAVLHDQKREKWDDGTYVPLRNMGEGAGEFL
VIDSILNEEAVMAFEYGFACSAPDKLTIWEAQFGDFANGAQVTIDQFLSSGETKWGRLCG
LTTILPHGYDGQGPEHSSGRVERWLQLCSEHNMQIIMPSEASQMFHLLQRQVLGSYRKPL
VIFMSKRLLRFKGAMSPLENFTEGSRFRPVIGDTAERGNNESVKRVILCAGQVYYDLEAG
RAERKLENDVAIVRVEQLYPFPYDEVRAELAKYPNAKSVVWAQEEPKNQGAFYQIRHRLE
DVIGESQKLSYAGRPSSASPAVGYMSKHVAQLKQLVEDAMTL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgaaaaactcaatttttcttatctgttcggttcaaatgctccctacatcgag
gagttgtatgagaatttcctggaaaaccccaattcggtcgatgaaaaatggaagcagtat
ttcaccgacttaagcaagcagcctggtgcggcggatgttgatatcgcccatgctccgatc
cgtgaatccttcgctaatttggcaaaaaccaaatcgacagcggctattgccggcggtatg
gatgaagccatgatgaagaaacaggtcggtgtattgcggttgatttctgcttaccgtatt
caaggtgtgggtgctgcccagcttgacccgctcaaacgtatcccgccacgcaacattgaa
gccctcgatcccaaattccacggactgaatgatgccgatatggcggttcagttcaatatg
ggcgagggcgatttttccggccaaagcaagctgcctctgtcccaaatcatcagcaacctc
aaacaaacctactgcggtcacctcgcattggaatacatctacattcccaatacagaagaa
cgccgctggttgcgcaattattttgaggatgtgctgtccaccccgagttacagcgccgaa
cagaaacgccgcatcctgaaagaaatgaccgctgccgagactttggagcgttacctgcat
accaaatatgtcggtcagaaacgcttcggcgtagaaggcggcgagagcgtgattgccggt
ctgaattacctgattcaaaacgcaggtaaagacggcgtcgaagaagtcatcatcggtatg
gcacaccgaggtcgtctgaatgtcttggtcaacattttgggcaagaaaccgggcgatttg
tttgccgaatttgaaggccgtgccgaaatcaagctgcccagcggcgacgtaaaataccac
atgggtttcagctccgacatcgctacgccgaacggtccgatgcacgtttctttggcgttc
aatccgtcgcatttggaaatcgtgaatcctgtcgttgaaggttctgcacgcgccaaacaa
aaacgcctgggcgaaaacggccgcgacaaagtattgcccgtattgattcacggcgactct
gcatttgtcggactgggtgtcaaccaagcaacgttcaacctgtccaaaacgcgcggctac
accaccggcggtacggtccacatcgtcatcaacaaccaaatcggctttaccacctccgat
acccgcgacacccgttcgaccgtgcattgtaccgacgtggcgaaaatggtttccgctccg
gtcatccatgtcaacggcgacgatccggaacgcgtttgcttcgccatccaagccgctttg
gactaccgtaagaaattcaacaaagacatcgtgatcgatgtcgtctgctaccgcaaatgg
ggccacaacgagggcgacgatccgaccctgacccagccgatgatgtacaaaaaagtatcg
caacaccccggtgcgcgtgctttgtacactgagcaactgattgcagaaggcgtggtaacg
caggcagaagccgacggctatatccaagcctaccgcgatgctttggacaaaggcgaacat
gtcgagcaaacgacgttgagcaacttccaacgtacgcaaatcgactggagcaaataccaa
ggtaaagactggcgcgaagatgtggaaaccggcctgcccgctgccgacatcgagcgtctt
gccgagaaatttaccgccgttcccgaaggctttgcactgcatccgactgccaaacgcgtg
ctcgaagcgcgcaaaggcatggctgcgggcagtcagccgattgactggggtatggcggaa
accctcgcatacgccagcctggtcaccaaaggccacggcgtgcgcatttccggcgaagac
tccggacgcggtacgttctcacaccgccatgccgtattgcacgaccaaaaacgcgaaaaa
tgggatgacggcacttatgtaccgctgcgcaatatgggcgaaggcgcaggcgaattcctc
gtcattgactccatcttgaatgaagaagcggtcatggcgttcgaatacggttttgcctgc
tccgcgcccgacaaactgaccatttgggaagcgcagttcggcgactttgccaacggcgcg
caagtgaccatcgaccaattcctgtcgtccggcgaaaccaaatggggccgtctctgcggt
ctgaccaccatcctgccgcacggttacgacggtcagggcccggaacactcatccggccgc
gtagaacgctggttgcaattgtgttccgaacacaatatgcaaatcatcatgccgtccgaa
gcgtcgcaaatgttccacctgctgcaacgccaagtcttgggttcgtaccgcaaaccgctg
gtgattttcatgtccaaacgcctgttgcgcttcaaaggcgcgatgagtccgctggaaaac
tttaccgaaggttcgcgcttccgtcccgtcatcggcgataccgccgagcgtggcaacaat
gaaagcgtgaaacgcgtgattctgtgtgccggacaggtttactacgatttggaagcaggc
cgtgccgagcgcaaactggaaaacgatgtcgccatcgtccgcgtcgagcagctttatccg
ttcccatacgacgaggtgcgtgcagagttggcgaaatatccgaacgcgaaatccgtggtt
tgggcacaagaagagccgaaaaaccaaggtgcgttctaccaaatccgccaccgcttggaa
gacgttatcggcgaaagccaaaaactgtcttatgccggtcgtccgagcagcgcatcgcca
gccgtcggctatatgagcaaacacgtcgcccagctgaaacaactggttgaagacgcaatg
acgctgtaa

DBGET integrated database retrieval system