KEGG   Neisseria sicca: A6J88_12615Help
Entry
A6J88_12615       CDS       T04958                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nsi  Neisseria sicca
Brite
Enzymes [BR:nsi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A6J88_12615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ARC51933
UniProt: A0A1V0HGL4
LinkDB All DBs
Position
complement(2553544..2554113)
Genome map
AA seq 189 aa AA seqDB search
MKFKTLVAVGISAICAAGVVNAHEHKHDHMTPAGASIKVKVQQLDPVNGNKDVGTVTITE
SKYGLVFTPNLRGLEAGLHGFHIHQNPSCEPKEKDGKLTAGLGAGGHWDPKETKKHGFPW
QDDAHLGDLPALTVLHDGTATNPVLAPRIKHLNEVRGHSIMIHVGGDNHSDHPAPLGGGG
ARMACGVIK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaaacactcgtagctgttggtatcagtgcaatctgtgctgcgggagtggtc
aatgcgcatgaacacaaacatgaccacatgacacctgccggtgcttctattaaagtgaaa
gtgcaacaacttgacccggttaatggtaataaagatgtaggcactgtaacgattaccgaa
tccaagtacggtttggtctttacgccaaacttaagaggattagaagccggcttgcatggc
tttcacattcaccaaaacccaagctgtgagccgaaggaaaaagacggtaaactgactgca
ggcttgggtgccggcggtcactgggatccgaaagaaaccaaaaaacacggtttcccatgg
caagatgatgcccacttaggcgatttgcctgcattaaccgtattgcacgacggcacagcc
accaatccggttcttgcgccacgcatcaaacaccttaatgaagttcgtggtcattctatt
atgatccacgttggtggcgacaatcattccgatcatcctgctccgcttggtggtggcggt
gcgcgtatggcgtgtggcgtgattaaatag

DBGET integrated database retrieval system