KEGG   Nocardia mangyaensis: BOX37_02305Help
Entry
BOX37_02305       CDS       T04582                                 

Definition
(GenBank) hypothetical protein
Organism
nsl  Nocardia mangyaensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha_GJ
Motif
Other DBs
NCBI-ProteinID: APE32994
UniProt: A0A1J0VLU4
LinkDB All DBs
Position
506715..507806
Genome map
AA seq 363 aa AA seqDB search
MPGNGSSGQGDSGQNPGGQTPGNGLPRELRLPGNGSSDGPAQGTPADGQGAAPVEPPSGA
PVADDEWAPLTIPGQSPADIPKKEVAGTGSASGSAAVGSAAGAGSAGAAAVLGTGSAGLG
VLLGTGSAGVGALLGTGSAGAAILLGTGSAGAAAVLGTGSAAGAAVLGTGSAAVGSAAAG
TGSAALGTGSAVLGTGSAAVGSAGVGSAGVGSAGVGSAAVGSAAVGSAAVGSATPLLLLL
IPIPSVPAAPALPPLAIPPSPAAPSVPAVPNVAVAAPVPAAEAPAPEAPPAATAAAPQAA
PSHEVMPTSDNSGLPEPKLLSVIGGLIALTLAGTGSGAVSFQGAAAAQARVNAARAEFFG
PRS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgccggggaatggaagcagtggtcagggcgacagcggccagaaccctggtggccagacc
ccggggaacggtcttcctcgtgagctgagactgccgggaaacggcagcagtgacggcccg
gcgcagggcacacccgctgacggccagggcgcggcccccgttgagccgccatcgggtgcg
ccggttgcagacgacgagtgggcaccgctcacgattccagggcaatcacccgccgacatc
ccgaagaaagaggtcgcgggcaccggttccgcgtcggggtcggccgctgtcggttcggcc
gcgggcgcgggttcggcaggcgccgccgcggtcctcggcaccggttcggctggtctcggc
gtgctgctcggtaccggttccgcgggtgtcggcgctctgctgggtaccggctcggccggc
gccgccatcctgctcggtacgggttcggcaggcgctgccgcggtcctcggtacgggttcc
gccgccggcgccgccgtgctcggcaccggctccgccgcagtcggttcggccgcggcgggt
accggttcggccgccctcggtaccggctccgctgtcctcggaacaggttctgccgcagtc
ggttccgccggtgtcggctcggcgggcgtcggttccgccggggtgggatcggccgctgtc
ggttcggccgctgtcggctccgcggcggtgggttcggccacgccgctgctgttgctgctg
atccctatcccgtcggttcccgcggctccggccttaccgcccctcgccataccgccttcc
cctgccgcgccctcggtgcccgccgtgccgaatgtcgctgtggcggcgccggttcccgct
gccgaggcacccgcccccgaggcgccgcccgcggccaccgccgcggcgccgcaggccgcg
cccagccacgaggtcatgccgaccagtgacaacagcgggctccccgagccgaagctgctg
tcggtgatcggcggcctgatcgcgctgacgctggccggaaccggttcgggcgcggtgagt
ttccaaggtgccgcggccgcccaagcgcgggtgaacgcggcgcgtgccgaattcttcgga
cccaggtcgtga

DBGET integrated database retrieval system