KEGG   Nocardia mangyaensis: BOX37_02550Help
Entry
BOX37_02550       CDS       T04582                                 

Definition
(GenBank) hypothetical protein
Organism
nsl  Nocardia mangyaensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPE T3SSipB
Motif
Other DBs
NCBI-ProteinID: APE33034
UniProt: A0A1J0VLY5
LinkDB All DBs
Position
complement(554296..555546)
Genome map
AA seq 416 aa AA seqDB search
MDAQANGNNERTRIYGDNAALSSGFDGEYTPQVVPPVMESFVGMPHSKIMEFVDSIGLTE
MSESVQRWEQLATDTTAKATAFHDNIQKEMERGWAGSAATAALTSTKNYLAEVHKVDQAA
SLIGNKMEEAYSGFNQVRYSVPHESDDQTKSKMGILVSYLAPGSGFLIDSTSNGRAAAAE
EAANEVMRTVYKPVAEQSDTQVPKVPEPTKPQSDNPVIDDGGGRRTDGDGSTNGGNDSNG
STGGGTQPTTTDPEDPSTTDPGTENPGDGTNPSTTENGTTTPETTDPNATTPAGTAPTTP
ASTVPSGLGTGGAGLGSGGGGGGGLGSGGSGMPGAGQSLPGGGQNQPLAASAGVGTGAAG
GRAGMTGMGGMGAPGARGGGKDDENEHNAPDYLRGVHEELLGPDRLHVPPVIGGDA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttggacgcccaggccaacggcaacaacgagcgcactcggatctatggcgacaacgcggcc
ctctcctcgggtttcgatggcgaatacacgccccaggtggtgccaccggtgatggaatcc
ttcgtcggcatgccgcactcgaagatcatggaattcgtcgattcgatcggtctcaccgag
atgtccgagagcgttcagcgttgggaacagctcgcgaccgacacgacagccaaggccaca
gccttccacgacaacatccagaaggaaatggagcgcggctgggcgggcagcgcagcgaca
gccgcactgaccagcaccaagaactacctcgccgaggtccacaaggtcgaccaggcagcc
tcgttgatcggcaacaagatggaagaggcgtactcgggcttcaatcaggtgaggtactcg
gtaccgcacgagtccgacgatcagaccaaatcgaagatgggaatcctcgtctcctacctg
gccccgggcagcgggttcctcatcgacagcaccagcaatgggcgtgcggcggcggccgag
gaagccgccaacgaggtgatgcgaaccgtctacaagccggtcgccgagcaatccgatacc
caggttccgaaggtccccgaacccacgaaaccgcagtcggacaatccggtcatcgacgat
ggcggcggcaggaggaccgacggggacggcagcaccaacggcggcaacgattcgaacggg
tccaccggcggcggcacgcagcccaccacgacagacccggaagacccgtccaccaccgac
ccgggcaccgagaaccccggcgacgggaccaatccgtcgaccacggagaacggcacgaca
acccccgagaccaccgacccgaacgcgaccactccggccggcacggccccgaccaccccg
gcgagcaccgtccccagcggcctcggcacgggcggcgctggcctcggctcaggcggaggc
ggcggtggcggtctcggttcgggcggcagcggcatgcctggcgcgggccagagcctgccc
ggcggtggccagaatcagcccctcgccgcctcggcgggtgtcggcaccggcgcggcgggc
ggtcgcgcgggtatgaccggcatgggcggcatgggtgcccccggtgcgcgcggcggcggc
aaggacgacgagaacgagcacaacgcccccgactacctgcgtggtgtgcacgaggaactg
ctcggcccggaccgcctgcacgttcctcccgtgatcggcggcgacgcatga

DBGET integrated database retrieval system