KEGG   Nocardia sp. Y48: BOX37_04520Help
Entry
BOX37_04520       CDS       T04582                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nsl  Nocardia sp. Y48
Pathway
nsl00020  Citrate cycle (TCA cycle)
nsl00480  Glutathione metabolism
nsl01100  Metabolic pathways
nsl01110  Biosynthesis of secondary metabolites
nsl01120  Microbial metabolism in diverse environments
nsl01130  Biosynthesis of antibiotics
nsl01200  Carbon metabolism
nsl01210  2-Oxocarboxylic acid metabolism
nsl01230  Biosynthesis of amino acids
Module
nsl_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOX37_04520
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BOX37_04520
Enzymes [BR:nsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BOX37_04520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: APE33351
UniProt: A0A1J0VMX4
LinkDB All DBs
Position
1008473..1009705
Genome map
AA seq 410 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDKTDDQVTVDA
ANAIKKHGVGVKCATITPDEDRVKEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVYEAGTVTLTFTPEDGSEPIVHEVVKMPADGGVVM
GMYNFKKSIVDFARASFNYGLQQNYPVYLSTKNTILKAYDGMFKDTFQEVFDAEFKAEFD
AAGLTYEHRLIDDMVASSMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
RTCEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIGFAQALE
DVVIKTVEGGQMTKDLALLVGGDQGYLSTEEFLGALDANLARTLSASPRI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaaggtaccgtcgtagaactcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggacaagctgatccatccgtatctcgacgtgaacctcgag
tactacgacctcggcatcgagtatcgcgacaagacagacgaccaggtcacagttgacgcc
gcgaacgccatcaagaagcacggcgtcggcgtcaaatgcgccaccatcacccccgacgaa
gaccgggtgaaggagttcggcctcaagaagatgtggcgctcgcccaacggcaccatccga
aacattctgggtggcaccatcttccgcgcgccgatcatcatctccaacgtgccccgcctg
gtgcccggctggaccaagccgatcatcatcggccgtcacgccttcggcgaccagtaccgc
gccaccgatttcaaggtttacgaggcgggtaccgtcacgctgaccttcacgcccgaggac
ggcagcgagccgatcgtgcacgaggtcgtgaagatgcccgccgacggcggcgtcgtcatg
ggtatgtacaacttcaagaagtcgatcgtggacttcgcgcgggcctcgttcaactacggc
ctgcagcagaactacccggtgtatctctccacgaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacaccttccaggaagtcttcgacgccgagttcaaggccgagttcgac
gcggcgggcctgacctacgagcaccgtctgatcgacgacatggtcgcctcctccatgaag
tgggagggcggctacgtctgggcctgtaagaactacgacggcgacgtgcagtccgacacc
gtggcccagggcttcggctcgctcggcctgatgacctcggtgctgctcaccccggacggt
cgcacctgcgaggccgaggccgcgcacggcaccgtcacccggcacttccgtcagcaccag
cagggcaagccgacctcgaccaacccgatcgcgtcgatcttcgcctggacccgcggcctc
gaacaccgcggcaagctggacaacacccccgaggtgatcggcttcgcgcaggcgctcgaa
gacgtcgtcatcaagaccgtcgagggtgggcagatgaccaaggatctggcgctgctcgtc
ggcggagatcagggatacctgagcaccgaggaattcctcggcgccctggacgccaacctg
gcccgcacgctgtccgcctctccgcgtatttag

DBGET integrated database retrieval system