KEGG   Nocardia sp. Y48: BOX37_04665Help
Entry
BOX37_04665       CDS       T04582                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nsl  Nocardia sp. Y48
Pathway
nsl00020  Citrate cycle (TCA cycle)
nsl00190  Oxidative phosphorylation
nsl00650  Butanoate metabolism
nsl01100  Metabolic pathways
nsl01110  Biosynthesis of secondary metabolites
nsl01120  Microbial metabolism in diverse environments
nsl01130  Biosynthesis of antibiotics
nsl01200  Carbon metabolism
Module
nsl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOX37_04665
   00650 Butanoate metabolism
    BOX37_04665
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BOX37_04665
Enzymes [BR:nsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BOX37_04665
    1.3.5.4  fumarate reductase (quinol)
     BOX37_04665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_16 Fer4_4 Fer4 Fer4_2
Motif
Other DBs
NCBI-ProteinID: APE33376
UniProt: A0A1J0VMW9
LinkDB All DBs
Position
complement(1037990..1038760)
Genome map
AA seq 256 aa AA seqDB search
MTAVAEPITQKPAPVPEGSVMVTVKVARFSTENDKGAYWDSFQVPVLPTDRFLNVLIYIK
SYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMKDLLPKGDKTLTMSVEPIRGLPV
EKDLIVDMEPFFDAFRAVKPYLMTSGNEPTRERIQSQADRARFDDTTKCILCACCTTSCP
VYWSDGSYFGPAAIVNAHRFIFDSRDEGARERLDILNDVEGVWRCRTTFNCTDACPRGIE
VTKAIQEVKRALLFTR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgtagccgaacccatcacccagaagcccgcgcccgtccccgagggctcggtc
atggtcaccgtgaaggtggcccggttcagcaccgagaacgacaagggcgcgtactgggat
tcgttccaggtgccggtcctgccgaccgaccgcttcctcaacgtgctgatctacatcaag
tcctatctggacggcaccctcaccttccggcgctcctgcgcccacggtgtgtgcggttcg
gacgcgatgcggatcaacggtgtgaaccggctggcctgcaaggtgctgatgaaggacttg
ctgcccaagggcgacaagaccctcaccatgtcggtggagccgatccgcggcctgcccgtg
gagaaggacctcatcgtcgacatggagccgttcttcgacgccttccgtgccgtgaagccg
tacctgatgacctcgggtaacgagccgacccgcgagcgcatccagagccaggccgaccgc
gcccgcttcgacgacaccaccaagtgcatcctgtgcgcctgctgcaccacctcctgcccc
gtgtactggagcgacggcagctacttcggcccggccgcgatcgtgaacgcgcaccgcttc
atcttcgacagccgtgacgagggcgcccgcgagcgcctcgacatcctcaacgacgtcgag
ggcgtgtggcgctgccgcaccaccttcaactgcaccgacgcgtgcccccgcggcatcgag
gtcaccaaggccatccaggaagtcaagcgggccctgctcttcacccgctga

DBGET integrated database retrieval system