KEGG   Nocardia soli: BOX37_09960Help
Entry
BOX37_09960       CDS       T04582                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nsl  Nocardia soli
Pathway
nsl00620  Pyruvate metabolism
nsl00680  Methane metabolism
nsl00710  Carbon fixation in photosynthetic organisms
nsl01100  Metabolic pathways
nsl01120  Microbial metabolism in diverse environments
nsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nsl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOX37_09960
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BOX37_09960
   00680 Methane metabolism
    BOX37_09960
Enzymes [BR:nsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BOX37_09960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APE34232
UniProt: A0A1J0VQA1
LinkDB All DBs
Position
2222244..2225015
Genome map
AA seq 923 aa AA seqDB search
MGESRIETEQEATRPLREDIRFLGGILGDTLRDHEGREVFDLVERVRTEAFRVRREEVER
SAVADMLDGTPTEVAIPLIRAFSYFVLLANLAEDLQRDRRRAVHVAAGEPPQDSSLAATY
DKLDAAAIDGATVAELLTDALVSPVITAHPTETRRRTVFDVQAKITELMRLRRRLAPGEP
GYDESELRIRREVLTLWRTALIRLARLRIQDEISVGLRYYDLTLYDVIPAINAQVRAALR
VRWPEVDLLARPILRPGSWIGGDRDGNPFVTAEVVHTAAEQAAAYAFGRYLRELVELEKT
LSQSARLVQVTPAVAALAEAGYPDPAFFADEPYRRALHAIRARLSATAQRSLGELPEHGL
DAGAAPYPTPQAVLDDLDAIDVSMRASGDALLADDRLAALRHAIETFGFHLQGLDMRQNS
EVHEQVVTELLAWSGVHADYPSLSEAERVELLAAELRTRRPLLGPNAQLSELTVKELGVL
CAAKEVIDTFGAAAIPNYIISMCTSVSDMLEAALLLKEAGILDPGSADNQPSCPVGIVPL
FETIEDLGAGASTLAAVLEVPVYRELVATAGMRQEVMLGYSDSNKDGGYLAANWALYRAE
LDLVEVAGKSGIRLRLFHGRGGTVGRGGGRSYDAILAQPAGAVRGSLRLTEQGEVIAAKY
SERGAAQRNLESLIAGTLESTLLDVEGLGEDAEPAYELLDDLAARARAAYARLVHETPGF
VEYFRQSTPVAEVGDLNIGSRPASRKPTNSVSDLRAIPWVMAWSQARVMLPGWYGTGTAL
EEWVGDDPERLARLTDLYQRWPFFRTVLSNLAQVMAKSDLDIAARYADLVTDEALRAQIF
GMIGDEHARTIRMYLAVTGHAGLLSDNPSLAESIHNRFPYLEPLNQLQVDLLRRLRGGDD
SELVKRGILLTMNGLATALRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaatcgcgaatcgagaccgaacaggaagccacccggccgctgcgcgaggacatc
cggtttctcggcggcatcctgggcgacaccctgcgcgaccacgaaggtcgcgaggtgttc
gatctggtcgagcgggtgcggaccgaggcattccgggtgcgccgcgaggaggtcgagcgc
agcgcggtcgccgacatgctcgacggcacgcccaccgaggtcgcgattccgctgatccgg
gcgttcagctacttcgtgctgctggccaacctggccgaggacctccagcgcgaccggcgc
cgcgccgtgcacgtggcggcgggggaaccgccgcaggactcctcgctggccgccacctac
gacaagctcgacgccgcggccatcgacggcgcgacagtggcagagctgctcaccgacgcg
ctcgtctccccggtcatcaccgcccaccccaccgagacccgcaggcgcaccgtcttcgac
gtgcaggccaagatcaccgagctgatgcgcctgcgccgccgcctcgcgcccggcgagccc
ggctacgacgaatcggaactgcggattcgccgtgaagtgctcaccctgtggcgcacggcg
ctgatccggttggcgcgcttgcggatccaggacgagatctcggtgggcctgcgctactac
gacctcaccctctacgacgtgatcccggccatcaacgcccaggttcgcgccgccctgcgt
gtccgctggcccgaggtcgacctgctggcgcgcccgatcctgcgccctggctcctggatc
ggcggcgaccgcgacggaaatccctttgtcactgccgaagtcgtgcacaccgcggccgag
caggccgccgcctacgccttcggccggtatctgcgtgagctggtcgaactggagaagacg
ctgtcgcagtcggcccgcctggtccaggtgacgcccgcggtggccgcgctcgccgaggcg
gggtatcccgatccggcgttcttcgccgacgaaccctatcgccgcgcgctgcacgcgatc
cgggcgcgcctgagcgccaccgcgcagcggtcgctgggcgagctgcccgagcacggtctc
gacgccggggccgcgccgtaccccaccccgcaggcagtgctcgacgacctcgacgcgatc
gatgtgtcgatgcgcgccagcggcgacgccctgctcgccgacgaccgcctcgccgccctg
cgccacgccatcgagaccttcggtttccacctgcagggtctggacatgcggcagaactcg
gaggtgcacgagcaggtcgtcaccgaactgctggcctggtcgggcgtgcacgcggactat
ccgagcctgtccgaggccgagcgcgtcgagttgctcgccgccgaattgcggacgcgccga
ccacttctgggcccgaacgcccagctgagcgagctcaccgtcaaggagctgggggtgctg
tgcgccgccaaggaggtgatcgacaccttcggcgccgccgcgatcccgaactacatcatc
agcatgtgcacctcggtcagcgacatgctcgaggccgcgctgctgctgaaagaggcgggc
atcctcgacccgggttcggccgacaaccagccgagctgccccgtcgggatcgtgccgctg
ttcgagaccatcgaggacctcggcgcgggcgcgtcgaccctggccgcggtgctcgaggtg
ccggtgtaccgcgaactcgtcgcgaccgcggggatgcggcaggaggtgatgctcggctac
tccgattccaacaaggacggcgggtatctggccgcgaactgggcgctctaccgcgcggaa
ctggacctggtggaggtggcaggcaagtcgggcatccggctgcggctgttccacggtcgc
ggcggcaccgtcggtcgtggcggcggacgcagttacgacgccatcctcgcccagcccgcc
ggtgcggtgcgcggttcgctgcggctcaccgagcagggtgaggtgatcgccgccaagtac
tccgaacgcggtgcggcacaacgcaatctggagtcactgatcgccggcaccctcgaatcg
accctgctggacgtggagggtctgggcgaggacgccgaaccggcctacgaactgctcgac
gatctggccgcccgcgctcgcgccgcctacgcgcgcctggtgcacgagactcccggcttc
gtcgagtatttccgccagtccacgccggtcgccgaggtcggcgatctcaacatcggtagc
cgccccgcctcgcgcaaacccacgaattcggtctcggatctgcgcgccatcccgtgggtg
atggcgtggagtcaggcccgggtgatgctgcccggctggtacggcaccggcaccgcgctc
gaggaatgggtgggcgatgaccccgaacgcctggcccgcctcaccgatctctaccagcgc
tggccgttcttccggacggtgctgtccaacctggcgcaggtgatggccaagagcgatctc
gacatcgccgcccgctacgccgacctggtcaccgacgaagccctgcgcgcgcagatcttc
ggcatgatcggcgacgaacacgcccgcaccatccgcatgtacctggcggtcaccgggcac
gccggcctgctcagcgacaacccgtcgctggcggagtcgatccacaaccgcttcccctac
ctggagccgctgaatcagctccaggtggacctgctgcgcaggctgcgcggcggtgacgat
tccgaactggtgaagcgtggcatcctgctcaccatgaacggcctggccaccgccctgcgc
aactcgggttag

DBGET integrated database retrieval system