KEGG   Nocardia mangyaensis: BOX37_12135Help
Entry
BOX37_12135       CDS       T04582                                 

Definition
(GenBank) NADH-quinone oxidoreductase subunit H
  KO
K00337  NADH-quinone oxidoreductase subunit H [EC:7.1.1.2]
Organism
nsl  Nocardia mangyaensis
Pathway
nsl00190  Oxidative phosphorylation
nsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BOX37_12135
Enzymes [BR:nsl01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BOX37_12135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADHdh Fer4 Fer4_7 Fer4_2 Fer4_16 Fer4_6 Fer4_10 Fer4_9 Fer4_8 Fer4_21 Fer4_17 Fer4_4 Fer4_3 Fer4_13 Fer4_22 Fer4_18 Fer4_15
Motif
Other DBs
NCBI-ProteinID: APE34581
UniProt: A0A1J0VRC3
LinkDB All DBs
Position
complement(2712141..2713925)
Genome map
AA seq 594 aa AA seqDB search
MSDRVLYVAAEGGTIFGTDPMWLVVVKALGVFVYLMLVPLIAVYAERKVVAWMQMRVGPN
RIGPKGMFQSIADGVKMALKEDIIPAIVDKPIFVLAPIISVIPAFMAFAVIPFGPEVSIF
GHQTALQLTDMPVAVLYILAITSIGVYGIVLAGWSSGSTYPLLGGLRSTAQVISYEIAMA
LTFATVFLLSGSMATSQIVSAQDGTWYVFLLLPSFLIYCVAMVGETNRAPFDLPEAEGEL
VGGFHTEYSSLKFAMFMLAEYVNMATVSALATTLFLGGWRAPFPISLWEGANSGWWPLLW
FTLKVWTFLFVFVWLRGTLPRLRYDQFMNLGWKLLIPTSLVWVMIVAGARVLDIEGIPGQ
TPILVGVGLVITAAMIGMFLRAGRSGGLPPLPEEPATSPVFLGFPVPPMPPRPVGEQAEI
GLFEPLAGFAVTAATMFKKPNTESYPEQKVPTAPRYHGRHQLNRYDDGLEKCIGCELCAW
ACPADAIFVEGADNTEDERFSPGERYGRVYQINYLRCIGCGLCIEACPTRALTMTNEYEM
TDDNRADLIYEKDQLLAPLQPGMAAPPHAMAPGTDDADYYLGRVGAAPSEEVLR
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcgtgtgctgtacgtcgcggccgagggcggaacgatcttcggcaccgacccg
atgtggctggtggtcgtcaaggcactgggtgtgttcgtctacctgatgctggtgccgttg
atcgcggtgtacgccgaacgcaaggtcgtcgcctggatgcagatgcgcgtcggccccaac
cggatcggcccgaagggcatgttccagtcgatcgccgacggcgtgaagatggcgctcaag
gaagacatcatcccggcgatcgtggacaagccgatcttcgtgctcgcccccatcatctcg
gtgattccggcattcatggcgttcgcggtgatcccgttcgggcccgaggtgtcgatcttc
gggcaccagacggcactgcagctcaccgacatgcccgtggccgtgctctacatcctcgcg
atcacctccatcggcgtgtacggcatcgtgctggccggctggtcatcgggctcgacgtat
ccgctgctcggcggcctgcgctcgaccgcgcaggtgatctcctacgagatcgccatggcg
ctcaccttcgccaccgtgttcctgctctcgggcagcatggccacctcccagatcgtgtcc
gcgcaggacggcacctggtacgtcttcctgctgctgccctcgttcctcatctactgcgtg
gcgatggtcggcgaaaccaaccgcgccccgttcgacctgcccgaggccgagggcgagctg
gtcggtggtttccacaccgagtactcctcgctcaagttcgcgatgttcatgctggccgag
tacgtcaacatggcgacggtgtcggcgctggcgaccacgctgttcctcggcgggtggcgg
gcgccgttcccgatcagcctgtgggagggcgcgaactccggctggtggccgctgttgtgg
ttcaccctcaaggtctggacgttcctgttcgtcttcgtctggctgcgcggcaccctgccc
cgcctgcgctacgaccagttcatgaatctcggctggaagctgctcatccccacgtcgctg
gtgtgggtgatgatcgtggccggtgcccgggtgctcgacatcgagggcatccccggccag
accccgatcctggtcggcgtcggcctggtgatcaccgcggcgatgatcggtatgttcctg
cgcgccgggcggtccggtgggctgccaccactgccggaggaaccggccacctcaccggtg
ttcctcgggttcccggtgccgccgatgccacctcggcccgtcggcgagcaggccgagatc
ggcttgttcgaaccgctggccggtttcgcggtcaccgcggccacgatgttcaagaagccc
aacaccgagtcctatcccgaacagaaggtgccgaccgcgccgcgctaccacggccgccac
cagctcaaccgctacgacgacggcctggagaagtgcatcgggtgcgagctgtgcgcctgg
gcctgcccggccgacgccatcttcgtcgagggcgccgacaacaccgaggacgaacgcttc
tcccccggtgagcggtacggccgggtgtatcagatcaactacctgcgctgcatcggctgc
ggcctgtgcatcgaggcctgccccacccgtgcgctgacgatgaccaacgagtacgagatg
accgacgacaaccgcgccgatctcatctacgagaaggaccagctgctggccccgctgcag
ccaggtatggccgccccaccgcacgccatggcgcccggcaccgacgatgccgactactac
ctgggccgcgtcggggccgccccgtcggaagaggtgctgcgatga

DBGET integrated database retrieval system