KEGG   Nocardia mangyaensis: BOX37_12600Help
Entry
BOX37_12600       CDS       T04582                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
nsl  Nocardia mangyaensis
Pathway
nsl00250  Alanine, aspartate and glutamate metabolism
nsl00410  beta-Alanine metabolism
nsl00640  Propanoate metabolism
nsl00650  Butanoate metabolism
nsl01100  Metabolic pathways
nsl01120  Microbial metabolism in diverse environments
Module
nsl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BOX37_12600
   00650 Butanoate metabolism
    BOX37_12600
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BOX37_12600
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BOX37_12600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nsl01007]
    BOX37_12600
Enzymes [BR:nsl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BOX37_12600
Amino acid related enzymes [BR:nsl01007]
 Aminotransferase (transaminase)
  Class III
   BOX37_12600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APE34656
UniProt: A0A1J0VRH9
LinkDB All DBs
Position
2799957..2801198
Genome map
AA seq 413 aa AA seqDB search
MTELSPILKQATPVRVDHGAGCYLYDADGRRYLDFTAGIGVTSTGHCHPTVVAAAQAQVA
RLIHGQYTTVMHKPLLELTERLGAVLPEGLDTLFFANSGSEAVEAALRLVRQATGRPNVV
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLMSGVHVAPFPTAYRYGWSEAEATDFALREL
DYLLATLTSPAETAAFIVEPVLGEGGYIPGNTRFFQGLRERADRHGILLVFDEIQTGFGR
TGKFFGHQHFDVRPDVITIAKGLASGFPLSGIAASRELMAKAWPGSQGGTYGGNAVACAA
AVATLDVIEAEGLVDNAAVRGAQLRSGVEQLATKAIGDVRGLGLLVGAEFTTATGEPDTA
TATAAQKAAVDKGLLLLTCGAHMNVVRMIPPLIVTDTQVDDALAIWSEVLAEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctgtctcccatcctgaagcaggccacgcccgtgcgggtcgaccacggcgcg
ggctgctacctctacgacgccgacggtcgccgctacctggatttcaccgcagggatcggc
gtcaccagcaccgggcactgccatcccaccgtggtggcggcggctcaggcccaggtcgcc
cgcctgatccacggccagtacacgacggtgatgcacaagccgctgctcgagctcaccgag
cgactcggcgccgtactgcccgaaggtctggacacgctgttcttcgccaattccggcagt
gaggcggtcgaggcggcactgcgcctggtgcgccaggccaccgggcgcccgaatgtggtc
gtcttccacggcggttttcacggccgcaccgtcgccgccgcgaccatgaccacctcgggg
acccggttctcagcggggttcagtccgctgatgtcgggtgtgcacgtggccccgttcccg
accgcctaccgctatggctggagcgaagccgaggccaccgacttcgcgctgcgcgagctc
gactatctgctcgccaccctgacctcgcccgcggagaccgccgcgttcatcgtcgaaccg
gtgctcggggagggcggctacatccccggcaacacccggttcttccagggtctgcgcgaa
cgcgccgaccggcatggcatcctgctggtcttcgacgagatccaaaccggcttcggccgc
accggaaagttcttcggccatcagcacttcgacgttcgtcccgacgtgatcaccatcgcc
aaaggtctggccagcgggttcccgctgtcgggcatcgcggcatcgcgggaactgatggcg
aaggcctggccgggctcccaagggggcacctacggcggcaacgccgtggcctgtgccgcc
gccgtggcgacactcgacgtcatcgaggccgagggcctggtcgacaacgcggcggtccgc
ggagcgcagttgcgcagcggcgtcgaacagctggccaccaaggcaatcggggatgttcgc
ggtctcgggctgctcgtcggagccgaattcaccacggcgaccggtgaacccgacaccgcg
acggcaacggccgcccagaaggctgccgtcgacaaggggctgctgttgctcacctgcggt
gcccacatgaacgtcgtgcggatgatcccgccgctgatcgtcaccgatacccaagtagac
gatgcgctggcgatctggtcggaagtcctcgccgagctgtag

DBGET integrated database retrieval system