KEGG   Nocardia mangyaensis: BOX37_21220Help
Entry
BOX37_21220       CDS       T04582                                 

Definition
(GenBank) magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nsl  Nocardia mangyaensis
Pathway
nsl00860  Porphyrin and chlorophyll metabolism
nsl01100  Metabolic pathways
nsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BOX37_21220
Enzymes [BR:nsl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BOX37_21220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_lid_2 VWA_2 Mg_chelatase AAA_5 VWA MCM Sigma54_activat VWA_3 AAA_16 AAA AAA_3 AAA_22
Motif
Other DBs
NCBI-ProteinID: APE36035
UniProt: A0A1J0VVF0
LinkDB All DBs
Position
complement(4741890..4743995)
Genome map
AA seq 701 aa AA seqDB search
MGEAGFPFSAVVGQERLQLALILSAVHPGIGGVLVRGEKGTAKSTVVRALAQLLPPVVDE
TGARPARLVELPVGATEDRVVGSLDLERVLRDGEQAFRPGLLAAAHHGVLYVDEVNLLHD
HLVDVLLDAAAMGRVHVERDGVSHSHPARFVLVGTMNPEEGELRPQLLDRFGLTVDVAAS
RQVDTRMAVVRRRLDYEADPDGFAARYADADQMVAERILTARDRLPAVALDNGELRRIAA
LCAAFDVDGMRADLVVARTATAHAAWRGRDRVTEDDVRIAAELALPHRRRRDPFDEPGIS
EEQLDEAMRAAADEVEKAAAAQDFDESSVAADADGEPDRSDRGQGRDEVEDSGGQDGVNG
PDGGGAGPIDGQPADGPQDGIPDDDGPDDGGPDGDGPDGGGPGDGPGGPPEGGPGSGSRP
GAESLSGTPGAANKPAPRWEVPGLGEGAPGRRSRAQTRTGRMVRPDTDTATGLHLLGTIF
AAAPRQFERGRFGGPLALAAEDLRGAYREGREGNLVVFVVDASGSMAARDRLTAVTGAIV
TLLRDAYQRRDKVAVISVRGSEAELVLPPTSSVDIAVRRLAGLRTGGKTPLAAGLRKARE
VIAREHVRDPRRRPMLVLLTDGRATGGIDPLPRARTAARLLAGEGHTAMVIDCERGMIRL
GLAADLARDLRARYLRLDELTGDTVADVVRGSSRGPSVRAA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
gtgggggaggcgggtttcccgttctcggctgtcgtcgggcaggagcggctgcaactggcc
ctgatcttgtcggcggtgcatcccggaatcggtggtgtgctggtgcggggcgagaagggc
accgcgaagtcgaccgtggtgcgcgcgctggcccagctgctgccgccggtggtggacgag
accggcgcccggcccgcgcggctggtggagttgccggtgggtgccaccgaggatcgcgtg
gtcggctcgctggatctcgagcgtgtgctgcgcgacggagagcaggcgttccggcccggt
ctgctggccgcggcccaccacggcgtgctctacgtcgacgaggtgaacctgctgcacgac
cacctggtcgacgtgctgctcgatgccgcggcgatggggcgggtgcacgtcgaacgtgac
ggcgtgtcgcattcgcacccggcgcgcttcgtcctggtcggcaccatgaaccccgaggaa
ggggagctgcgcccgcagctgctcgaccggttcgggctcaccgtcgacgtggccgcctcc
cgccaggtggacacccgcatggccgtggtgcgcaggcgcctggactacgaagccgacccc
gacggattcgccgcgcgctacgccgatgccgatcagatggtcgccgaacggattctgacc
gcgcgcgaccggctgcccgcggtggccctggacaacggggaactgcgccggatcgcggcg
ctgtgcgcggcgttcgacgtcgacgggatgcgcgcggatctggttgtcgcccggaccgcc
accgcgcacgcggcgtggcgcgggcgcgatcgggtgaccgaggacgacgtgcgcatcgcg
gccgaactggcgctgccgcaccggcgcaggcgtgatccgttcgacgagcccggcatcagt
gaggaacagctcgacgaggcgatgcgggcggcggccgacgaggtcgagaaggccgctgcg
gcccaggatttcgacgagtcgtcggtcgccgctgacgcggacggggagccggaccgaagt
gatcgcgggcagggtcgagacgaggtcgaggactcgggcggtcaggacggtgtgaacggg
ccggacggcggtggcgccggcccgatcgacggccaacccgccgatggtccgcaggacggt
attcccgacgacgatggccccgatgacggtggcccggacggcgacggccccgatggcggt
ggtcccggcgacggtcccggcggtccgcccgagggtggtcccggctcgggttctcgcccg
ggcgcggaaagtctttcgggcacaccgggtgcagcgaacaagcccgccccgcgctgggag
gtccccggtctcggcgagggcgcgcccggtcgacgctcgcgcgcgcagacccgcaccggt
cgcatggtccgccccgataccgacaccgccaccggactgcacctgctcggcaccatcttc
gccgccgccccacggcaattcgagcgtggccgcttcggtggcccgctcgccctggccgcc
gaggatctgcgtggcgcgtatcgcgaagggcgcgaagggaacctggtcgtcttcgtggtc
gacgcctccggctcgatggccgcccgcgaccgcctcaccgccgtcaccggcgccatcgtc
accctgctgcgcgacgcctaccagcgccgcgacaaggtggcggtgatcagcgtgcgcggc
agcgaagccgaactcgtgctgccccccacctcctcggtcgacatcgccgtccgccgcctg
gccggactgcgcaccggcggcaagacccccctcgcggccggtctgcgcaaggcccgcgag
gtgatcgcccgtgaacacgtccgcgacccccgccgccgtccgatgctggtcctgctcacc
gacggccgcgccaccggcggcatcgacccgctgccccgcgcccgcaccgccgcgcgtctg
ctggccggtgaaggtcacaccgccatggtcatcgactgcgaacgcggcatgatccgcctc
ggcctggccgccgacctcgcccgcgacctgcgcgcccgctacctgcgcctcgacgaactc
accggtgacacggtcgccgacgtggtccggggttcctcccgcggtccgtccgtccgcgcc
gcgtag

DBGET integrated database retrieval system