KEGG   Nocardia mangyaensis: BOX37_21420Help
Entry
BOX37_21420       CDS       T04582                                 

Definition
(GenBank) hypothetical protein
Organism
nsl  Nocardia mangyaensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioesterase Hydrolase_4 Abhydrolase_3 Pyr_redox Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: APE36063
UniProt: A0A1J0VVU6
LinkDB All DBs
Position
complement(4782733..4783737)
Genome map
AA seq 334 aa AA seqDB search
MPIHDDADGTPPMACGFAPDRPEDCPAVDHDRSSAVPGPTDDRPASATVVPIRPLGTTVD
GPPLFCFPGEAVLAWSFAALVHHLDPRVPIYGVQTSAPAPTIAAYASRHLAEIRRLAPHG
PYQLLGWSVGGLIAHEVAARLRTAGEQVTVVLLATELSAPGPPDLAPIAPEGAERMPTPR
RPTGPGPATPPRPATTPGPDFVERFAAVLGIDAAITHRSAAAAAVLAAPWTDALGLTAAD
LDRLGEASTAIARAGAGHRPSILSGDLTLCVPGRAPDGTDRPDPGVDVRSWRPYVAGTVT
GVVLDAGSGELIDPELMPDIAGIIAAVSAPRQNP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgcccattcacgatgatgccgacggcaccccgccgatggcctgcgggttcgcgccggac
cggcccgaggactgtccggcggtcgaccacgaccgctcgtccgccgtccccggtccgacc
gatgatcggccggcgtcggcgacggtggtgccgatccgcccactcggcaccaccgtcgac
ggcccaccgctgttctgcttccccggcgaagcggttctggcctggagtttcgccgccctg
gtgcaccacctcgacccccgcgtgccgatctacggggtgcagacgagtgcccctgccccg
accattgccgcctacgcgagccgacacctcgccgagatccgccgcctcgcgccacacggc
ccgtaccagctgctcggctggtcggtcggcggattgatcgcccacgaggtcgccgcacgg
ctgcgcacggcaggcgaacaggtcactgtcgtgctgctggccaccgagctgtccgccccc
ggcccaccggacctggcgccgatcgcgcccgagggagcagaacgtatgccgacgccgcga
cgtccgaccgggccgggacctgcgacaccgccgcgacccgcgacaacgccgggcccggac
ttcgtggagcggttcgccgccgtgctcggcatcgacgccgccatcacccatcgcagcgcc
gccgcggccgccgtgctcgccgcgccatggacggatgccctcggcctcaccgctgccgac
ctcgatcgcctcggcgaagcgagcaccgccattgcgcgcgcgggtgccggtcatcggccg
tcgatcctgtccggggatctgaccctgtgcgtccccggccgtgcaccagacggaaccgac
cggcccgatcccggtgtggacgtgcgtagctggcgcccctacgtcgcagggacggtcacc
ggcgtggtcctcgacgcgggttccggcgaactgatcgatcccgagttgatgcccgacatc
gccgggatcatcgccgccgtgtccgcaccacggcagaacccttga

DBGET integrated database retrieval system