KEGG   Nocardia mangyaensis: BOX37_30805Help
Entry
BOX37_30805       CDS       T04582                                 

Definition
(GenBank) hypothetical protein
Organism
nsl  Nocardia mangyaensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4878 DUF3999 SnoaL_3 Lumazine_bd_2 DUF4440
Motif
Other DBs
NCBI-ProteinID: APE38888
UniProt: A0A1J0W3K9
LinkDB All DBs
Position
6902797..6903645
Genome map
AA seq 282 aa AA seqDB search
MRVVNPADAPTTAFPVQRGTDRVVPPVGGRPAVTPPPNTPRGPVGPRQAGQQGGPHGPGA
PQGPAGPQGPHGPGFDETLPSSQPGPAGPPRQSASAPSPADIQPTRPAEQVAERQRQVAP
PQRIEAPQVGGPDAPGPKRSKRWVWAVGAAAVLVLALIATVVALMTGGDNSPEGQVRTAI
GEYTDALRGGDLEALRSSTCGQLNEFYQDLTTEEFNGVHQLSTEEGSLPIVASVDAVRIT
GDTALAEATVFTESDPEQTARTFDLERTDGEWKVCDPTGTTP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcgtgaatccggcggatgcgccgaccacggcgtttcccgtccagcggggcacg
gatcgggtggtgcctccggtgggaggtcggcctgcggtgactccgccgccgaatacgccg
cggggccccgtcggacctcggcaggcggggcagcaaggtgggccgcacgggccaggggcg
ccgcaagggccggctggtccacagggaccacacggccccgggttcgacgagactctgcct
tcgtcgcagccggggccggccggaccgccgcgacagtcggcgtcggcgccctcgcccgct
gatattcagccgactcggcccgccgagcaggtggcggagcggcagcggcaggtggcgccg
ccgcagcggatcgaagcgccgcaggtcggtgggccggatgcccccgggccgaagcggtcg
aagcggtgggtgtgggcggtgggtgcggccgcggtgttggtgctcgcgctgatcgcgacc
gtggtggcgctgatgaccggtggggacaattcgccggagggacaggtgcggaccgcgatc
ggcgagtacaccgacgcgctgcgcggcggcgatctcgaggccttgcggtcgagcacgtgc
gggcagctgaacgagttctaccaggacctcaccaccgaggaattcaacggcgtgcatcag
ctctcgaccgaggagggttcgctgccgatcgtcgcgagtgtggacgcggtgcggatcacc
ggcgacaccgccctggccgaggccacggtcttcaccgagagcgacccggagcagaccgcg
cgcacgttcgacctggagcgcaccgacggtgagtggaaggtctgcgaccccaccggcacc
acgccctga

DBGET integrated database retrieval system