KEGG   Nocardia mangyaensis: BOX37_31025Help
Entry
BOX37_31025       CDS       T04582                                 

Definition
(GenBank) molecular chaperone
Organism
nsl  Nocardia mangyaensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 FGGY_C MreB_Mbl StbA
Motif
Other DBs
NCBI-ProteinID: APE37632
UniProt: A0A1J0VZV7
LinkDB All DBs
Position
6958003..6959364
Genome map
AA seq 453 aa AA seqDB search
MSSVLGVSVGAGTVRLARPQLGDTQGSNAPYSFEVQSISMPEQQADEAAADVIAGALAAS
PEIAATTITFRSEPQARAIRAAMARRQLTNYQLVPEAVAAVHFAHATSDMREVSTLAVYD
LGSSGLTVSVVNARTSDVYQCERISDISGDYLDSLIREQQIASGRIAHPADPAGLAALDG
LCRAAKEQLSNSNAVALPSEQGLVLLTQENFEALMMLAIESSARMARDVIIRAQHPVQAI
LVVGGGARIPLIARVLERTIGVPVIVPAEPEAALARGAVLLARPAQVQQAPAATPVVAAL
GDEHDSTPAWLTAPARRRSPLSALAHRANSRRELNAAVLTVSSLVVVAGIGLGLGYGPEV
LERGSASEDSQAVPATTPPRPSVAAPTSAPVTTTEAVHETVAAPPVRQQATEPTDAGPPP
PGPNTYTVVPGLPPIVVPTLPPVMLPGFPGPGQ
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggttctgggagtttcggtgggggcgggcacggtgcgcctggcgcgcccgcag
ctcggcgacacccaggggagcaacgcgccgtattcgttcgaggtgcagtcgatttcgatg
cccgagcagcaggccgacgaagcggcggccgatgtgatcgccggcgcgctggccgcgtcg
cccgagatcgccgcgaccaccatcaccttccgcagcgaaccgcaggccagggccatccgc
gccgcgatggcgcgccgccagctcaccaactaccagctcgttcccgaggccgtcgccgcc
gtgcacttcgcgcacgcgaccagcgatatgcgcgaggtgtccacgctggccgtctacgac
ctgggcagttcgggcctcaccgtgagcgtggtgaacgcgcgcaccagcgatgtctaccag
tgcgagcggatcagcgacatcagtggcgactacctggattcgctgatccgcgagcagcag
atcgcctcgggccggatcgcgcatccggccgacccggccggactggccgcgctcgacggt
ctgtgccgggccgccaaggagcagctgtcgaacagcaacgcggtggcgctgcccagtgag
cagggcctcgttctgctcacgcaggagaatttcgaagcgctgatgatgctggcgatcgag
tcctcggcgcggatggcccgcgacgtgatcatccgcgcgcagcatccggtgcaggcgatc
ctggtggtcggcggcggcgcgcggattccgctgatcgcgcgcgtcctcgagcgcacgatc
ggcgttccggtgatcgtgcccgccgagccggaggccgcactcgcccgtggcgccgtgctg
ctggccaggcccgcgcaagtccagcaggcgcccgccgccacacccgtcgtcgctgcgctc
ggtgacgagcacgattcgaccccggcctggctgaccgcgcccgcccgccggcgcagtccg
ctcagcgcgctcgcccaccgcgcgaattcccgccgcgagctcaatgccgctgtcctgacg
gtgagttcgctggtggtggtcgccgggatcggtctcggcctcggctacgggcccgaggtg
ttggagcgcggttcggcgagcgaggactcccaggcggtgcccgcgaccacaccaccgcgc
ccgagcgtcgcggcgccgacctcggccccggtcaccaccaccgaggccgtacacgagacc
gtggccgcgccgccggtgcgacagcaggccacggaaccgaccgacgcgggaccaccgccg
cccggcccgaacacctacaccgtggtgccgggcctgccgccgatcgtcgtaccgacgctg
ccgccggtgatgctgccgggcttccccggccccggccagtaa

DBGET integrated database retrieval system