KEGG   Nocardia sp. Y48: BOX37_31475Help
Entry
BOX37_31475       CDS       T04582                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
nsl  Nocardia sp. Y48
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APE37712
UniProt: A0A1J0W038
LinkDB All DBs
Position
7052157..7053602
Genome map
AA seq 481 aa AA seqDB search
MHYDSLFIGGKWTTPAGGDRISVVSPATEETVGSVPAVTKADVDAAVAAARDAFDSGPWP
STPPLERAEVLTKAAQLIEQRSPELLAALTAEMGAPSLAALTLNQIPAVAALNAVAELAK
TFQWNETRVGLFGTSRVSREPRGVVAAITAWNVPLFLAANKLGPALLAGCTVVLKPSPLT
PLTANLLADIFTEAGLPDGVLSVLPAEAEASEYLAGHPGVDKVTFTGSTAVGRKLAALAG
EQLKTVSLELGGKSAAIVLPDADLAASIPVLAFSGLMNSGQGCVAQTRILAPRSRYEEII
DALVAHVKTMQTGDPTDPATQLGPLISEQQRDRVESYIAKGKEEGARLVLGGGRPAGVEK
GWFVEPTIFADVDNASTIAQEEIFGPVLSVIPYDTEDEAIAIANDSDYGLAGSVWTTDIE
HGVEVAARVRTGTYAINWYAFDPTAPFGGYKNSGIGRENGPEGLDAFCEQKSVLMPMGWT
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcactacgacagcctgttcatcggcggcaagtggaccaccccggccggtggtgaccgc
atttccgtggtctcacccgcaacggaggaaaccgtcggcagcgtgcccgcggtgacgaag
gccgacgtggacgcggcggtcgccgcggcccgcgacgccttcgacagcggaccgtggcca
tcgactcccccactggaacgagccgaggtactcaccaaggccgcgcagctgatcgagcaa
cgatcgccggaattgctcgccgcgctcaccgcagagatgggcgcgccctcgctagcggcc
ttgacactcaaccagattccagccgtcgccgcactcaacgcggtcgccgagctcgcgaag
acgtttcagtggaacgagactcgggtcggcttgttcggaacctcgcgcgtctcacgggaa
ccgcgcggcgtggtggccgcgatcaccgcctggaacgtcccgttgttcctcgccgcgaac
aagctcggccccgcgttgctcgccgggtgcacggtggtgctcaagccctcgccgctcacc
ccgctcaccgccaatctgctcgccgacatcttcaccgaggccgggctgcccgacggcgtg
ctctcggtgctgcccgccgaagcggaggcgagtgagtacctggccgggcatcccggcgtc
gacaaggtcaccttcaccggttccaccgcggtcggccggaaactggccgcgctcgccggt
gagcagctcaagaccgtctcgctcgaactgggcggcaagtcggccgccatcgtgctgccc
gatgccgacctcgcggccagcattcccgtccttgcgttctccggattgatgaacagcggg
cagggctgcgtggcgcagacccgcatcctggccccgcgcagccggtacgaggagatcatc
gacgcgctggtcgcgcacgtgaagaccatgcagaccggcgatcccaccgatccggccacc
cagctcggcccgctgatcagcgagcagcagcgtgatcgggtggagagctacatcgccaag
ggcaaggaagagggcgcgcggctcgtgctcggcggcggacggcctgccggggtcgagaag
ggctggttcgtcgagccgaccatcttcgccgacgtcgacaacgcgagcaccatcgcccag
gaggagatcttcggcccggtgctctcggtgatcccctacgacaccgaggacgaggccatc
gccatcgccaacgattccgactacggcctggccgggtcggtgtggaccaccgacatcgaa
cacggtgtcgaggtcgccgcacgggtgcgcaccggcacctacgcgatcaactggtacgcc
ttcgacccgaccgcgcccttcggtgggtacaagaactccggcatcggccgcgagaacggc
ccggagggcctcgacgcgttctgcgagcagaagtccgtcctgatgcccatgggctggacc
ggctag

DBGET integrated database retrieval system