KEGG   Nocardia sp. Y48: BOX37_32085Help
Entry
BOX37_32085       CDS       T04582                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nsl  Nocardia sp. Y48
Pathway
nsl00020  Citrate cycle (TCA cycle)
nsl00190  Oxidative phosphorylation
nsl00650  Butanoate metabolism
nsl01100  Metabolic pathways
nsl01110  Biosynthesis of secondary metabolites
nsl01120  Microbial metabolism in diverse environments
nsl01130  Biosynthesis of antibiotics
nsl01200  Carbon metabolism
Module
nsl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOX37_32085
   00650 Butanoate metabolism
    BOX37_32085
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BOX37_32085
Enzymes [BR:nsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BOX37_32085
    1.3.5.4  fumarate reductase (quinol)
     BOX37_32085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like FAD_oxidored GIDA Thi4 Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: APE37804
UniProt: A0A1J0W0G0
LinkDB All DBs
Position
7182963..7184972
Genome map
AA seq 669 aa AA seqDB search
MPEVEQHDYDVVVIGAGGAGLRAVIEAREQGLSVAVVCKSLFGKAHTVMAEGGCAASMGN
ANDKDNWQTHFKDTMRGGKFLNNWRMAELHAREAPDRVWELETYGALFDRTADGRISQRN
FGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDYAETGDYEARIKVFAECTITELFTD
AGASGQGPEEAAGVTTQGPRSHRDGHGRIAGAFGYWRESGGFILFRTPAIVLATGGIGKS
YTVTSNSWEYTGDGHALALRAGATLINMEFLQFHPTGMVWPPSVKGILVTEGVRGDGGVL
KNSEGKRFMFDYIPPVFKGQYAETEEEADQWLRDNDSARRTPDLLPRDEVARAINEEVKA
GRGTEHGGVFLDIASRMPADEIVRRLPSMHHQFKELADVDITAEPMEVGPTCHYVMGGIE
VDPDTGAARTPGLFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGASAYVKQLTDKPL
PTDADVAAAATTALAPFDSSSSADGENPYTLHAELQQTMNDLVGIIRKEHEVRAAIEKLA
QLRERYARVAVAGKRPFNPGWHLAIDLANMLLVSECVAQAALLRTESRGGHTRDDHPGMN
PDWRNTLLVCALDPATTDAPVPGVTVTPADQTPMREDLLALFELGELEKYYTEQELAEHP
AAGSAEGKA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagtggaacagcacgactacgacgtcgtggtgatcggggcgggcggcgcgggc
cttcgcgcggtgatcgaggcgcgtgagcagggactctcggtggcagtggtgtgcaagtcg
ctgttcggcaaggcgcacaccgtgatggccgagggcggctgcgcggcctcgatgggcaat
gccaacgacaaggacaactggcagacccatttcaaggacaccatgcgcgggggcaagttc
ctcaacaactggcggatggccgaattgcacgcccgcgaagcgcccgaccgggtgtgggag
ctggaaacctatggggcgctgttcgatcggaccgccgacgggcggatcagccagcgcaat
ttcggcggacacacctatccgcgccttgcccacgtgggcgaccgcaccggcctggaactg
atccgcaccatgcagcagaagatcgtctcgctgcagcaagaggactacgcggagaccggt
gattacgaggccaggatcaaggtcttcgccgaatgcaccatcaccgaattgttcaccgac
gccggcgcgagcggtcagggcccggaggaggcagcgggcgtcaccacgcagggcccccgc
tcgcaccgagacgggcacggccgaatcgcgggggcgttcgggtattggcgcgaatcaggc
ggattcattctgttccgcaccccggcgatcgtgctggccaccggcggcatcggcaagtcc
tacacggtgacctcgaactcctgggagtacaccggcgacggccacgcactggccctgcgc
gcgggcgcgacgctgatcaacatggagttcctgcagttccaccccaccggcatggtctgg
ccgccgagcgtgaagggcatcctggtcaccgagggcgtgcgcggtgacggcggggtgctg
aagaactccgagggcaagcggttcatgttcgactacatcccgccggtgttcaagggccag
tacgccgaaaccgaggaggaagccgatcagtggctgcgcgacaacgattccgcgcgccgc
acccccgatctgctcccccgcgacgaggtggcccgcgcgatcaacgaggaggtcaaggcg
ggccgcggcaccgagcacggtggcgtgttcctcgacatcgcctcccgcatgcccgccgac
gagatcgtgcgcaggctgccctcgatgcatcaccagttcaaggaactggccgacgtcgac
atcaccgcggagccgatggaagtgggcccgacctgccactacgtgatgggcggtatcgag
gtcgaccccgataccggcgcggcccgcacccccggattgttcgccgccggtgagtgttcc
ggtgggatgcacggttccaaccggctcggtggcaattccttgtcggacctgctggtgttc
ggtcgacgagccggactcggcgcctcggcctacgtcaaacaactcaccgacaaacccctg
cccaccgatgccgacgtcgcggctgcggcgacaaccgcactggcgccgttcgattcgtct
tcctcggctgacggcgagaacccctacaccctgcacgccgagttgcagcagacgatgaac
gacctggtcggcatcatccgcaaggaacacgaggtgcgtgcggccatcgagaagctggcc
caattgcgcgaacgctacgcccgggtcgccgtggccgggaagcgtccgttcaaccccggc
tggcacctcgcgatcgacctggcgaacatgctgctggtcagcgaatgtgtcgctcaggca
gcgctgttgcgcaccgagagcagaggcggacacacccgcgacgaccaccccggtatgaac
ccggactggcgcaacaccctgctggtgtgcgcgctggatccggccaccactgatgcgccg
gtgcccggagtcaccgtgaccccggccgatcagacgccgatgcgcgaggacctgctcgcc
ctgttcgaactgggcgagctcgagaagtactacaccgagcaggaattggccgagcatccg
gcggccggctcggccgagggaaaggcgtag

DBGET integrated database retrieval system