KEGG   Nocardia sp. Y48: BOX37_32090Help
Entry
BOX37_32090       CDS       T04582                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nsl  Nocardia sp. Y48
Pathway
nsl00020  Citrate cycle (TCA cycle)
nsl00190  Oxidative phosphorylation
nsl00650  Butanoate metabolism
nsl01100  Metabolic pathways
nsl01110  Biosynthesis of secondary metabolites
nsl01120  Microbial metabolism in diverse environments
nsl01130  Biosynthesis of antibiotics
nsl01200  Carbon metabolism
Module
nsl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOX37_32090
   00650 Butanoate metabolism
    BOX37_32090
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BOX37_32090
Enzymes [BR:nsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BOX37_32090
    1.3.5.4  fumarate reductase (quinol)
     BOX37_32090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: APE37805
UniProt: A0A1J0W0L3
LinkDB All DBs
Position
7184975..7185721
Genome map
AA seq 248 aa AA seqDB search
MGYDARFRVWRGDLDGGGLQDYTVAVNEGEVVLDIIHRLQATQTPDLAVRWNCKAGKCGS
CSAEVNGRPRLLCMTRMSTFTPDEVITVTPMRTFPIIKDLVTDVSFNYEKAREIPSFTPP
PGLAPGDYRMKQVDVERSQEFRKCIECFLCQDTCHVVRDHEENKQAFSGPRYLMRITELE
MHPLDTADRREMAQNEAGLGYCNITKCCTEVCPEHIKITDNALIPLKERVVDRKYDPIVW
LGNKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggatatgacgcccggttccgggtctggcgtggcgatctcgacggcggtggcctgcag
gactacacggtcgcggtcaacgagggcgaagtggtgctcgacatcatccatcgtctgcaa
gccacccagactcccgatctggcggtgcgctggaattgcaaagcgggcaaatgtggttcg
tgttcggcggaggtgaacgggcgcccgcgattgctgtgcatgacgcggatgtcgacgttc
acccccgacgaggtgatcaccgtgactccgatgcgcaccttcccgatcatcaaggatctg
gtcaccgacgtctcgttcaactacgaaaaggccagggagataccgtcgttcaccccaccg
ccggggttggcacccggtgactaccggatgaagcaggtggatgtggaacgctcccaggag
ttccgcaagtgcatcgagtgcttcctgtgccaggacacctgccatgtggtccgtgatcac
gaggagaacaagcaggccttctccggaccgcggtatctgatgcgcatcaccgagctggag
atgcatccactcgacaccgccgaccggcgcgaaatggcccagaacgaggcgggtctgggc
tattgcaatatcaccaagtgctgcaccgaggtgtgcccagaacacatcaagatcaccgac
aacgccctgatcccgttgaaggagcgagtcgtggatcgcaagtacgatccgatcgtctgg
ctgggcaacaagctgttccgacggtag

DBGET integrated database retrieval system