KEGG   Nocardioides seonyuensis: EXE58_14895
Entry
EXE58_14895       CDS       T06627                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
nsn  Nocardioides seonyuensis
Pathway
nsn00900  Terpenoid backbone biosynthesis
nsn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EXE58_14895
Enzymes [BR:nsn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     EXE58_14895
SSDB
Motif
Pfam: Prenyltransf TetR_C_25 Terminase_4
Other DBs
NCBI-ProteinID: QBX56625
UniProt: A0A4P7IH69
LinkDB
Position
3067706..3068485
AA seq 259 aa
MKRQVRPPSPHPSGARPPAIPAELLPEHVAIVMDGNGRWAKDRGLPRTKGHEAGEFSLFD
IVEGAIEVGVKAISAYAFSTENWSRSPDEVRFLMGFNRDVVRRRRDEMHDMGVRVRWAGR
APRLWKSVIKELKDAEELTKHNDVMTLTMCVNYGGRSEIADAARAVAQDVAAGRIKPDKV
DEKVFARYLYVPELPDADLIWRTSGEQRLSNFMLWQAAYSEFAYTDKLWPDVDRRDLWAA
IETYARRDRRYGGALPNPT
NT seq 780 nt   +upstreamnt  +downstreamnt
gtgaagcgccaggtccgcccgcccagcccgcacccgagcggcgcacgtccgcccgccatt
ccggcggagctgctgcccgagcacgtcgcgatcgtgatggacggcaacggccgctgggcc
aaggaccgcggcctgcctcgcaccaagggccacgaggccggggagttctccctcttcgac
atcgtcgagggagccatcgaggtcggcgtcaaggcgatctccgcctacgcgttctccacc
gagaactggtcccgctcgcccgacgaggtccgcttcctgatgggcttcaaccgcgacgtc
gtacgacgccgacgcgacgagatgcacgacatgggcgtccgagtgcgatgggcaggtcgg
gcaccacgattgtggaagtccgtcatcaaggagctcaaggacgccgaggagctcaccaag
cacaacgacgtcatgaccctgacgatgtgcgtcaactacggcgggaggtccgagatcgcg
gacgcagcccgcgccgtcgcccaggacgtcgcggccgggcgcatcaagccggacaaggtc
gacgagaaggtgttcgcgcgctacctctacgtccccgagctgcccgacgccgacctcatc
tggcggaccagcggcgagcagcgcctctccaacttcatgctctggcaggcggcctacagc
gagttcgcctacaccgacaagctctggcccgacgtcgaccgtcgcgacctctgggcggcg
atcgagacctacgcacgacgtgaccgccgctatggcggagcgctgcccaaccccacctga

DBGET integrated database retrieval system