KEGG   Niabella soli: NIASO_01140Help
Entry
NIASO_01140       CDS       T03682                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
nso  Niabella soli
Pathway
nso00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nso01100  Metabolic pathways
nso01110  Biosynthesis of secondary metabolites
nso01130  Biosynthesis of antibiotics
nso01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIASO_01140
Enzymes [BR:nso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     NIASO_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AHF14172
UniProt: W0ETV3
LinkDB All DBs
Position
273810..274802
Genome map
AA seq 330 aa AA seqDB search
MNSFGQLFRVQIFGESHGECVGVVLDGVPAGLAVPVEDFLPDMERRKGGNQKGATPRKED
DIPIFKSGVFNEKTTGFPVMIYFENKNTRSGDYEKLRSFPRPGHADFVAHKKFGGFEDYR
GGGHFSARLTTGLVAGGVIAKKLLRNITIDAVITEIGGDPDPERGLQKAIDAKDSVGGLI
ECRVKGLPVGLGEPYFDSVESLLAHMLFTIPAVKGVEFGSGFAAAKMFGSQHNDPIETME
GKTSTNHAGGIVGGITNGNELVFRIAIKPTASTPKPQHSLNWETGQMEDFSVKGRHDLCV
ALRAPVIVEAVTAIVLADLMMQAGHIARVI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattcggccagttattcagagtgcagatatttggagaatcgcatggggagtgc
gtgggagtggtgttggacggggttcctgcgggccttgcggttccggtggaagattttttg
cccgatatggagcgccggaagggaggcaaccaaaagggtgccacgccccggaaagaagac
gatattcctatttttaagagcggtgtttttaatgagaaaacaaccggcttcccggtaatg
atctattttgaaaataagaatacgcgcagcggcgattatgagaaattaagaagtttcccc
cggccgggtcatgcagattttgttgcgcataaaaaatttggcggctttgaagactaccgg
ggtggcggccatttcagcgcccgtcttacaacaggtttggttgctggcggtgttatcgcg
aaaaagttattgaggaacattacgatcgatgctgttataacagaaatcggcggtgatccc
gatccggagcgcgggcttcaaaaagctatcgatgcaaaagattccgtagggggattgatc
gaatgccgcgtaaagggcctgccggttgggttaggagaaccttattttgactcagtagag
tcattgttggcacatatgttatttacgatcccagcggttaagggggtggagttcggaagc
ggttttgcggctgcaaaaatgttcggctctcaacataatgaccccatcgaaactatggag
ggaaaaacgtccaccaaccatgcgggaggcattgtaggggggatcactaatggcaatgag
ctggttttccgtatcgccattaagccaacagcctctacccccaagccccagcacagcctg
aactgggaaaccggccaaatggaagatttttcagtaaaagggcgccatgatctttgtgtg
gctttacgtgcaccggtaattgtagaggcggtaacggcaattgtattggctgacctgatg
atgcaggcaggtcatattgcacgggtcatttga

DBGET integrated database retrieval system