KEGG   Niabella soli: NIASO_12320Help
Entry
NIASO_12320       CDS       T03682                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nso  Niabella soli
Pathway
nso00620  Pyruvate metabolism
nso00680  Methane metabolism
nso01100  Metabolic pathways
nso01120  Microbial metabolism in diverse environments
nso01200  Carbon metabolism
Module
nso_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIASO_12320
  09102 Energy metabolism
   00680 Methane metabolism
    NIASO_12320
Enzymes [BR:nso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NIASO_12320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHF15724
UniProt: W0F2M1
LinkDB All DBs
Position
complement(2675326..2677908)
Genome map
AA seq 860 aa AA seqDB search
MDVVASQSVQRFKNDVGVRFQLYNSLFTSLPFHKIEKTGILLSLLSSMCEEGYEKGSSPV
TIIEDFFSRHTSLTVPREQLDLLFRFVQYVERQVVLFDALEDASYKKINDVNGPGTLKQL
MAAVVQNNREQQFDKVLEDFCVRLVLTAHPTQFYPGSVLGIIRDLSNALVKNDASEINTL
LQQLGKTPFFKKIKPTPFDEAVSLIWYLENVFYPAAGRILNELKNQFPAIAADKHALIKM
GFWPGGDRDGNPFVTTDTTLQVAAALRGAILKCYYFDVRRLRRRLTFHDVEDIMSDLERR
LYEEVFIPGKDAKITDKEIISILKGVKQIVIERANGLFVSRIQDLISKIEIFGLHFASLD
IRQDSSIHEKVFSQIAASPAGLLPKDYDSLEENEKVKLLLNLKQIDTASIFGDSVVRDTV
EVVNAICAIQNSNGEQGCNRYIISHATSVLSIIEVIGLFKLNGIDNDEINVDIVPLFETI
EDLQNAGEVMKTLYSLPEYKALLERRGKTQTIMLGFSDGTKDGGYLMANWSIYRAKEELT
RITRQYGFDVIFFDGRGGPPSRGGGKTHKFYASMGRNISNKEIQLTIQGQTVSANFGIID
SAQFNIEQLINAGVSSSLFADRYPPLNGKQEQLLQELSSYGFDAYVQLKNHPQLANYLYE
MSPLRFYSETNIGSRPAKRGQQQTTISLGDLRAIPFSGAWSQLKQNVPGFFGVGTALKRM
EYIGRFDELKQLYNESLYFKTLLDNCEMAMSKSYFPITAYIANDEQFGDIWQMIYDEFAL
TKQYIYKLTGHDTLMASYPVDKLSIRMRERIVMPLVTIQQYALVKLRDGNSELEDSLREA
YEKLVMRCSFGIINAGRNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggtagcgagtcagtccgttcagcgctttaagaacgatgttggcgtacgattc
caattatataatagtttatttacttctttgccctttcacaaaattgagaagacaggaatt
ttattgtcgctattgtccagtatgtgtgaggaagggtatgaaaaaggatcgagccctgta
acaattatagaagatttttttagccgccacacatccttaaccgtgcccagggaacaactg
gatctcctgttccggttcgtgcaatatgtagagcgccaggtggttttgtttgatgcactg
gaagacgcttcttataaaaagataaacgatgttaacggtccgggtacgttaaaacaattg
atggctgctgtggttcaaaacaacagggagcagcagtttgataaggtgctggaagatttt
tgtgtacggctggtattaaccgctcaccctacccagttttatccgggttccgtgttggga
attatccgggacctgagcaatgcattggttaaaaatgacgccagtgaaataaatacactg
ctgcaacagttgggtaaaacacccttctttaaaaagattaaacctactccttttgatgaa
gcagtaagcctcatctggtatcttgaaaatgttttttatccggcggcgggccgtatactc
aacgaactgaaaaaccagttccccgctattgccgcggataaacatgcgcttataaaaatg
ggcttttggcccggtggcgaccgcgatgggaatcccttcgtaactacagataccaccctg
caggtggccgccgcattgcggggggctattttaaaatgttattattttgatgtgcgcaga
ctgcggcgccggctaacctttcatgatgtggaagatattatgagcgatctggagcgtcgc
ttatatgaagaagtcttcatcccgggaaaggatgccaaaataaccgacaaagaaattatt
tccattctcaagggcgtaaagcaaattgttattgaaagagcaaacggattatttgtatcc
cggatacaggatctgatcagcaagatagaaatattcggactgcactttgcatcactggat
ataagacaggacagttccattcatgaaaaagtcttttcacagatagcggcctcacctgcc
ggcctgctgccaaaggattacgatagcctggaggaaaacgaaaaagtgaaactgctgctg
aatcttaaacaaattgatacggcatcaatattcggcgacagtgttgtcagggatacggtt
gaagtagtgaacgctatctgtgccatacaaaattcaaatggagagcagggctgcaaccgg
tatattatcagccatgctaccagtgtgctgagcattattgaagtaataggcctgtttaaa
ctgaacggcattgacaacgacgaaatcaatgtagacattgttccgctttttgaaacaatt
gaagacttgcaaaatgcgggagaggttatgaaaaccctttattccctcccggaatataag
gcgcttttagagcgccggggtaaaacacaaaccatcatgctgggcttttctgatggtaca
aaggacggtggctacctgatggccaactggagcatttaccgcgccaaggaagagctgacg
cgtattacaagacaatacgggtttgatgttattttctttgatggccgtggcggccctccc
tcccgtggcggcggaaaaacccataagttctatgcatctatggggcgcaatatttccaat
aaagagatccaactgacaatacagggccaaacagtgagcgccaattttggtattattgat
tcggcgcagtttaatattgaacaactgattaatgcgggggtctccagctccctttttgct
gaccggtatcctccgttaaacggaaagcaggagcaattgttgcaagagctttcttcctat
ggttttgatgcttacgtacagttgaaaaaccatccgcaactggccaattacttatatgaa
atgagccctctgcgcttttatagcgaaacgaatatcggaagccggccggctaaaagaggc
cagcaacaaactaccatttcattgggcgatttacgcgccatccctttctccggcgcctgg
agccagttgaagcaaaatgtacccggcttttttggcgtaggcaccgcgttaaaacgaatg
gaatatatcgggcgctttgatgagctgaagcaattgtacaacgaatcgttgtactttaaa
acgctgctggataattgcgaaatggccatgagcaaatcctatttcccgataacggcctac
atcgcaaacgatgagcagtttggcgatatctggcaaatgatttatgatgagtttgcttta
acgaaacaatacatttacaaactaaccgggcatgatacattaatggcttcctacccggta
gataaattgtctatccgtatgcgggagcggatcgtaatgccgttggttaccattcagcaa
tatgcactggtaaaactgcgcgatggaaacagcgagctggaagattcgttgcgtgaggcc
tacgaaaagctggtaatgcgttgttctttcggtatcatcaacgcaggaagaaattcggcg
tag

DBGET integrated database retrieval system